Acinonyx jubatus (cheetah): 106975168 Help Entry 106975168         CDS       T04657                                  Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04015   Rap1 signaling pathway aju04810   Regulation of actin cytoskeleton aju05014   Amyotrophic lateral sclerosis aju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106975168  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106975168  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106975168   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106975168  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106975168   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106975168    04147 Exosome [BR:aju04147]     106975168 Membrane trafficking [BR:aju04131]  Others   Actin-binding proteins    Others     106975168 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106975168 Exosome [BR:aju04147]  Exosomal proteins   Proteins found in most exosomes    106975168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106975168 NCBI-ProteinID:  XP_026917414 UniProt:  A0A6J1ZL75 LinkDB All DBs Position C2:112486446..112504952 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtaggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system