Acinonyx jubatus (cheetah): 106975963 Help Entry 106975963         CDS       T04657                                  Name (RefSeq) thioredoxin-like isoform X1   KO K03671   thioredoxin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04621   NOD-like receptor signaling pathway aju05012   Parkinson disease aju05132   Salmonella infection aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106975963  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106975963   09164 Neurodegenerative disease    05012 Parkinson disease     106975963   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106975963  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aju03110]     106975963 Chaperones and folding catalysts [BR:aju03110]  Protein folding catalysts   Protein disulfide isomerase    106975963 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_7 Disulph_isomer Motif Other DBs NCBI-GeneID:  106975963 NCBI-ProteinID:  XP_053081126 LinkDB All DBs Position B3:142377998..142378435 Genome browser AA seq 100 aa AA seqDB search MVKQIESKYAFQEALNSEGNTLVVDFSATGCGPCTMVKSISHALSEKDPNVVCLEVDVGD CQRLLQSVKPTLPFLKKEQKVGEFSGADKEKLEATINELI NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggtaaagcagatcgagagcaaatatgcttttcaggaagccttgaacagtgaggggaac actttagtagttgacttctctgccacagggtgtgggccttgcacaatggtcaagtccatc tctcatgccctctctgagaaggatcccaacgtggtgtgccttgaagtagatgtgggtgac tgtcagaggttgcttcagagtgtgaagccaaccctcccatttttaaaaaaggaacagaag gtgggtgaattttctggagctgataaggaaaaacttgaagctaccattaatgaattaatc taa

DBGET integrated database retrieval system