Acinonyx jubatus (cheetah): 106977704 Help Entry 106977704         CDS       T04657                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism aju  Acinonyx jubatus (cheetah) Pathway aju04137   Mitophagy - animal aju04140   Autophagy - animal aju04144   Endocytosis aju04145   Phagosome aju04148   Efferocytosis aju05132   Salmonella infection aju05146   Amoebiasis aju05152   Tuberculosis Brite KEGG Orthology (KO) [BR:aju00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106977704    04145 Phagosome     106977704    04140 Autophagy - animal     106977704    04137 Mitophagy - animal     106977704    04148 Efferocytosis     106977704  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106977704    05152 Tuberculosis     106977704   09174 Infectious disease: parasitic    05146 Amoebiasis     106977704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106977704   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106977704    04031 GTP-binding proteins [BR:aju04031]     106977704 Membrane trafficking [BR:aju04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     106977704 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106977704   Exosomal proteins of other body fluids (saliva and urine)    106977704   Exosomal proteins of colorectal cancer cells    106977704   Exosomal proteins of bladder cancer cells    106977704 GTP-binding proteins [BR:aju04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     106977704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  106977704 NCBI-ProteinID:  XP_026905620 UniProt:  A0A6J1YN86 LinkDB All DBs Position A2:109639755..109710028 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggacaggaacggttccagtcccttggtgtggccttctacagaggc gcagactgctgcgttctggtatttgacgtcactgcccccaacacattcaaaacccttgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccccttc gtggtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaaacaggaaacagaggtg gagctgtacaacgaattccccgaacccatcaaactggacaagaacgaccgggccaaggcc tcggcggaaagctgcagttgctga

DBGET integrated database retrieval system