KEGG   Acinonyx jubatus (cheetah): 106979122
Entry
106979122         CDS       T04657                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04610  Complement and coagulation cascades
aju04810  Regulation of actin cytoskeleton
aju05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106979122 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    106979122 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    106979122 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aju04515]
    106979122 (ITGAX)
   04090 CD molecules [BR:aju04090]
    106979122 (ITGAX)
Cell adhesion molecules [BR:aju04515]
 Integrins
  Integrin alpha subunits
   106979122 (ITGAX)
CD molecules [BR:aju04090]
 Proteins
  106979122 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2 VWA_CoxE
Other DBs
NCBI-GeneID: 106979122
NCBI-ProteinID: XP_014932383
UniProt: A0A6I9ZVD8
LinkDB
Position
Unknown
AA seq 1201 aa
MLTTSLSASILLTTSLLTGPSVPLSSSLSGRGTQKPISYLPVMTMIRTFLLLMGLASSLC
FNLDTDQPTTFLMESAGFGYSVVQYANSWVVVGAPQEIKAANQTGSLYQCDYRTGKCEPI
RLKIPPEAVNMSLGLSLAASTNPSQLLACGPTVHHTCKENMYLTGFCFLLVSPSWQAQRL
PAALQECPRQEQDIVFLIDGSGSISFRDFTKMLNFVKAVMSQFQRPSTQFSLMQFSHHSW
VHFTFKDFIYSSNPLGLLDSVQQLRGFTYTATAIQMVTNQLFSASSGARKDASKILIVIT
DGQKQGDPLGYEDVIPRAEAAGIIRYAVGVGLAFQNPHSRKELNDIASKPSHEHIFQVEN
FDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAVFSPDGPVLGAVGSFSWSGG
AFLYPQNMSPTFINMSQENVDMRDSYLGYSTELALWKGVKILILGAPRHQHTGKVVIFTQ
ASGQWRPKAEVAGTQIGSYFGASLCSVDVNRDGNSDLVLIGAPHYYKPTRGGQVSMCHLP
LGRARWQCEVILCGEQGHPWGRFGAALTVLGDVNGDKLTDVAIGAPGEQENRGAVYLFHG
TSELGISPSHSQRISGSQLSPSLQYFGQSLSGGQDLTLDGLVDLAVGAQGQVMLLRTRPV
LRVWMNIQFTSAEIARSVFECREETASVKALGDANVCLRIYESPKNQLGDLQSSVTFDLT
LDPGRQNPRAIFEETKARNLTHVRVLGLRQYCETVRLLLLACVEDSVTPITLRLNFSLVG
KPIPSFGNLQPILAVDAQRYFVASLPFEKNCGTDHVCQDDLGISFDFSGLKTLVVGSTLE
LNMKVTVWNDGEDSYGTTITFFYPPGLSYRRVAGSQNQLQAHSPSLTCDGTPAQGQSTQS
TRCSINHLIFHEGAKMTFMVTFDVSPKAILGDRLLLTANVSSENTTPRTSKTTFQMELMV
KYAIYTVISSHEESTKYLNFSALDWEESSQAQHRYQVNNLGQRDLPVSINFSVPVELNGV
PVWTELGVFHPQNPSIQCSSERMVPIESDFLTHIQKNPVLNCSIADCLRFHCDLPSFGVQ
EELDFILKGNLSFGWVSQTLQKKVLIVSVAEIMFNTSVYAQLPGQEAFLRAQMEMVLEKY
EVYNTVPIIVGSSLGGLLLLALITVILYKVGFFKRQYKEMMEEANGQTIPENGTSDPQAS
Q
NT seq 3606 nt   +upstreamnt  +downstreamnt
atgctgacaacttccctctctgcttctattctcctgactacctctctgctcactggcccc
tctgtacctttgtccagttccctcagtggccgaggaactcagaagcccatatcttacctt
ccagtcatgaccatgatcaggaccttcctcctgttgatgggcttggcttcttctctctgt
ttcaacttggatacagaccagccaacaaccttccttatggagagtgctgggtttggatac
agtgtggtccagtatgccaactcctgggtggtggttggagccccccaggagataaaggct
gccaaccaaacaggtagcctctaccagtgtgactatagaacgggcaagtgtgagcccatc
cgcctgaagatccccccagaagcagtgaacatgtccttgggcctgtccctggcagcctca
accaacccctctcaactgctggcctgtggccccacagtgcaccatacatgcaaggagaac
atgtacttgactgggttctgtttcctgctggtttccccttcctggcaggcccagaggctc
ccggctgccttgcaggagtgtccaaggcaggagcaggatattgtgttcctgatcgatggc
tcaggcagcatctccttcagagattttaccaagatgttgaattttgtgaaggccgttatg
agccagttccagagacctagcacccagttctctctgatgcagttctcccaccactcctgg
gtgcacttcactttcaaagacttcatatacagctcaaacccactaggcctgttggattct
gtacaacagctgcgagggttcacttacacagctacagccatccaaatggttacaaatcaa
ctgttcagtgcctcaagtggggcccgaaaagatgcctccaagatccttattgtcatcact
gatggtcagaaacaaggagaccccctgggttatgaggatgttatccctagggctgaagct
gccggtatcattcgctatgcagttggggtgggattggcttttcaaaacccacattcccgg
aaagaattaaatgacattgcatcgaagccctcccatgagcacatttttcaagtggagaat
tttgatgctttgagagacattcaaaaccaactgaaagagaagatctttgccattgagggt
acgcagaccataagcagtagttcctttgaattggagatgtcccaggagggtttcagcgct
gtgttctcacctgacgggccagttctgggggctgtggggagcttcagctggtctggagga
gccttcctatacccccaaaatatgagccccactttcatcaacatgtctcaagagaatgtg
gacatgagggactcttatctaggttactccactgagctggcactttggaagggggtgaag
atcctgatcctgggggccccccgccatcagcatactgggaaggttgtcatcttcactcag
gcatccgggcaatggaggccgaaggctgaagttgcagggacccagattggttcctacttt
ggggcctccctctgctctgtcgatgtgaacagagatggcaactctgacctcgtcctcatt
ggggctccacattactacaagccaacccggggggggcaggtgtccatgtgccacttgccc
ctggggagagctagatggcagtgtgaggtcattctctgtggggagcagggccacccctgg
ggccgctttggggcagccttgacagtgctgggggatgtgaatggggacaagctgacagat
gtggccattggggccccaggagagcaggagaaccggggtgctgtctacctatttcatgga
acctcagaactgggcatcagcccctcccacagccagcggatctcaggctcccagctttcc
cccagcctccagtattttgggcagtcactgagtgggggtcaggaccttaccctggatgga
ctggtggacctggctgtgggggcccaggggcaggtgatgttgctaaggaccagacctgtg
ctcagggtgtggatgaatatccaattcacatctgcagagattgccaggtctgtgtttgaa
tgtcgggaagagacagcctctgtcaaggcactgggtgatgccaacgtctgccttcgtatt
tatgaaagtcccaagaatcagctgggtgacctccaaagctctgtgacctttgacctgacc
ctcgaccctggccgccagaatccccgtgccatctttgaggagacaaaagcccggaatctg
actcatgtccgagtccttgggctgagacagtactgtgagaccgtgaggttgctcctcctg
gcctgtgtggaggactcagtgacccccatcaccttgcgtctcaacttctccctggtgggc
aaacctatcccttcctttggaaacctccagcctatcttggctgtggatgctcagcgatac
ttcgtggcctctcttccctttgagaagaattgtggaactgaccatgtctgtcaggatgac
cttggcatctcctttgacttctcaggcttgaagactctggtggtggggagtaccctggag
ctgaatatgaaagtgacagtgtggaatgatggtgaagactcctatggaaccacaatcacc
ttcttctaccctccagggctgtcttatcgtcgtgtggcagggagccagaaccagctgcag
gcacactccccaagcctgacctgtgatggcaccccagcccagggccagagtactcagagc
acccgttgcagcatcaaccacctcatcttccatgagggtgctaagatgaccttcatggtc
acctttgacgtctcccccaaggccatactgggtgataggttgcttctgacagctaatgtg
agcagtgaaaatactacccccaggaccagcaagaccacctttcagatggagctcatggtg
aagtatgccatctacactgtgatcagcagccatgaagagtccaccaagtacctcaacttc
tcagccttggactgggaggaaagcagccaggctcagcatagataccaggtgaacaatctg
ggacagagggacctgcctgtcagcatcaacttctctgtgcctgtggagctgaatggggtg
cctgtgtggacagagttaggggttttccacccccagaacccctccattcagtgttcttca
gagagaatggtgcccatagagtctgacttcctgacccacattcagaagaatcccgtgctg
aactgctcaattgctgattgcctgaggttccactgtgacctgccttcctttggcgtccag
gaggaacttgacttcatcctaaagggcaacctcagctttggctgggtcagccagacattg
cagaagaaggtattgattgtgagtgtggctgaaatcatgttcaacacctctgtgtatgcc
cagcttccaggacaggaggcattcttgagagctcagatggagatggtactggagaagtat
gaggtctacaacactgtccccattattgtgggcagctctttgggaggactgctgctgctg
gctctcatcacagtcattctgtataaggttggcttcttcaaacgtcagtataaggaaatg
atggaggaagcaaatggacagactatcccagaaaatgggacatcagaccctcaagcttcc
caataa

DBGET integrated database retrieval system