Acinonyx jubatus (cheetah): 106979239 Help Entry 106979239         CDS       T04657                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism aju  Acinonyx jubatus (cheetah) Pathway aju04014   Ras signaling pathway aju04015   Rap1 signaling pathway aju04022   cGMP-PKG signaling pathway aju04024   cAMP signaling pathway aju04062   Chemokine signaling pathway aju04071   Sphingolipid signaling pathway aju04072   Phospholipase D signaling pathway aju04081   Hormone signaling aju04144   Endocytosis aju04150   mTOR signaling pathway aju04270   Vascular smooth muscle contraction aju04310   Wnt signaling pathway aju04350   TGF-beta signaling pathway aju04360   Axon guidance aju04510   Focal adhesion aju04517   IgSF CAM signaling aju04520   Adherens junction aju04530   Tight junction aju04611   Platelet activation aju04621   NOD-like receptor signaling pathway aju04625   C-type lectin receptor signaling pathway aju04660   T cell receptor signaling pathway aju04670   Leukocyte transendothelial migration aju04722   Neurotrophin signaling pathway aju04810   Regulation of actin cytoskeleton aju04921   Oxytocin signaling pathway aju04928   Parathyroid hormone synthesis, secretion and action aju04972   Pancreatic secretion aju05100   Bacterial invasion of epithelial cells aju05132   Salmonella infection aju05133   Pertussis aju05135   Yersinia infection aju05152   Tuberculosis aju05163   Human cytomegalovirus infection aju05200   Pathways in cancer aju05203   Viral carcinogenesis aju05205   Proteoglycans in cancer aju05206   MicroRNAs in cancer aju05210   Colorectal cancer aju05417   Lipid and atherosclerosis aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106979239    04015 Rap1 signaling pathway     106979239    04310 Wnt signaling pathway     106979239    04350 TGF-beta signaling pathway     106979239    04072 Phospholipase D signaling pathway     106979239    04071 Sphingolipid signaling pathway     106979239    04024 cAMP signaling pathway     106979239    04022 cGMP-PKG signaling pathway     106979239    04150 mTOR signaling pathway     106979239   09133 Signaling molecules and interaction    04081 Hormone signaling     106979239    04517 IgSF CAM signaling     106979239  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106979239   09144 Cellular community - eukaryotes    04510 Focal adhesion     106979239    04520 Adherens junction     106979239    04530 Tight junction     106979239   09142 Cell motility    04810 Regulation of actin cytoskeleton     106979239  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     106979239    04621 NOD-like receptor signaling pathway     106979239    04625 C-type lectin receptor signaling pathway     106979239    04660 T cell receptor signaling pathway     106979239    04670 Leukocyte transendothelial migration     106979239    04062 Chemokine signaling pathway     106979239   09152 Endocrine system    04921 Oxytocin signaling pathway     106979239    04928 Parathyroid hormone synthesis, secretion and action     106979239   09153 Circulatory system    04270 Vascular smooth muscle contraction     106979239   09154 Digestive system    04972 Pancreatic secretion     106979239   09156 Nervous system    04722 Neurotrophin signaling pathway     106979239   09158 Development and regeneration    04360 Axon guidance     106979239  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106979239    05206 MicroRNAs in cancer     106979239    05205 Proteoglycans in cancer     106979239    05203 Viral carcinogenesis     106979239   09162 Cancer: specific types    05210 Colorectal cancer     106979239   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     106979239   09171 Infectious disease: bacterial    05132 Salmonella infection     106979239    05135 Yersinia infection     106979239    05133 Pertussis     106979239    05152 Tuberculosis     106979239    05100 Bacterial invasion of epithelial cells     106979239   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106979239    05418 Fluid shear stress and atherosclerosis     106979239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106979239   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106979239    04031 GTP-binding proteins [BR:aju04031]     106979239 Membrane trafficking [BR:aju04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     106979239 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106979239   Exosomal proteins of other body fluids (saliva and urine)    106979239   Exosomal proteins of colorectal cancer cells    106979239   Exosomal proteins of bladder cancer cells    106979239 GTP-binding proteins [BR:aju04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     106979239 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  106979239 NCBI-ProteinID:  XP_026894515 UniProt:  A0A6J1XPR4 LinkDB All DBs Position A2:147532219..147594457 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtcttcagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccggtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacaagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system