KEGG   Acinonyx jubatus (cheetah): 106980282
Entry
106980282         CDS       T04657                                 
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju04010  MAPK signaling pathway
aju04012  ErbB signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04062  Chemokine signaling pathway
aju04066  HIF-1 signaling pathway
aju04068  FoxO signaling pathway
aju04071  Sphingolipid signaling pathway
aju04072  Phospholipase D signaling pathway
aju04114  Oocyte meiosis
aju04140  Autophagy - animal
aju04148  Efferocytosis
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04218  Cellular senescence
aju04270  Vascular smooth muscle contraction
aju04370  VEGF signaling pathway
aju04371  Apelin signaling pathway
aju04380  Osteoclast differentiation
aju04510  Focal adhesion
aju04540  Gap junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04613  Neutrophil extracellular trap formation
aju04620  Toll-like receptor signaling pathway
aju04650  Natural killer cell mediated cytotoxicity
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04664  Fc epsilon RI signaling pathway
aju04666  Fc gamma R-mediated phagocytosis
aju04668  TNF signaling pathway
aju04720  Long-term potentiation
aju04722  Neurotrophin signaling pathway
aju04725  Cholinergic synapse
aju04726  Serotonergic synapse
aju04730  Long-term depression
aju04810  Regulation of actin cytoskeleton
aju04910  Insulin signaling pathway
aju04912  GnRH signaling pathway
aju04914  Progesterone-mediated oocyte maturation
aju04915  Estrogen signaling pathway
aju04916  Melanogenesis
aju04917  Prolactin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju04921  Oxytocin signaling pathway
aju04926  Relaxin signaling pathway
aju04928  Parathyroid hormone synthesis, secretion and action
aju04929  GnRH secretion
aju04934  Cushing syndrome
aju04935  Growth hormone synthesis, secretion and action
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05034  Alcoholism
aju05132  Salmonella infection
aju05135  Yersinia infection
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05207  Chemical carcinogenesis - receptor activation
aju05208  Chemical carcinogenesis - reactive oxygen species
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05230  Central carbon metabolism in cancer
aju05231  Choline metabolism in cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106980282
   04012 ErbB signaling pathway
    106980282
   04014 Ras signaling pathway
    106980282
   04015 Rap1 signaling pathway
    106980282
   04370 VEGF signaling pathway
    106980282
   04371 Apelin signaling pathway
    106980282
   04668 TNF signaling pathway
    106980282
   04066 HIF-1 signaling pathway
    106980282
   04068 FoxO signaling pathway
    106980282
   04072 Phospholipase D signaling pathway
    106980282
   04071 Sphingolipid signaling pathway
    106980282
   04024 cAMP signaling pathway
    106980282
   04022 cGMP-PKG signaling pathway
    106980282
   04151 PI3K-Akt signaling pathway
    106980282
   04150 mTOR signaling pathway
    106980282
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106980282
   04148 Efferocytosis
    106980282
  09143 Cell growth and death
   04114 Oocyte meiosis
    106980282
   04210 Apoptosis
    106980282
   04218 Cellular senescence
    106980282
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106980282
   04540 Gap junction
    106980282
   04550 Signaling pathways regulating pluripotency of stem cells
    106980282
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106980282
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    106980282
   04620 Toll-like receptor signaling pathway
    106980282
   04650 Natural killer cell mediated cytotoxicity
    106980282
   04660 T cell receptor signaling pathway
    106980282
   04662 B cell receptor signaling pathway
    106980282
   04664 Fc epsilon RI signaling pathway
    106980282
   04666 Fc gamma R-mediated phagocytosis
    106980282
   04062 Chemokine signaling pathway
    106980282
  09152 Endocrine system
   04910 Insulin signaling pathway
    106980282
   04929 GnRH secretion
    106980282
   04912 GnRH signaling pathway
    106980282
   04915 Estrogen signaling pathway
    106980282
   04914 Progesterone-mediated oocyte maturation
    106980282
   04917 Prolactin signaling pathway
    106980282
   04921 Oxytocin signaling pathway
    106980282
   04926 Relaxin signaling pathway
    106980282
   04935 Growth hormone synthesis, secretion and action
    106980282
   04919 Thyroid hormone signaling pathway
    106980282
   04928 Parathyroid hormone synthesis, secretion and action
    106980282
   04916 Melanogenesis
    106980282
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106980282
  09156 Nervous system
   04725 Cholinergic synapse
    106980282
   04726 Serotonergic synapse
    106980282
   04720 Long-term potentiation
    106980282
   04730 Long-term depression
    106980282
   04722 Neurotrophin signaling pathway
    106980282
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106980282
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106980282
   05206 MicroRNAs in cancer
    106980282
   05205 Proteoglycans in cancer
    106980282
   05207 Chemical carcinogenesis - receptor activation
    106980282
   05208 Chemical carcinogenesis - reactive oxygen species
    106980282
   05230 Central carbon metabolism in cancer
    106980282
   05231 Choline metabolism in cancer
    106980282
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106980282
  09162 Cancer: specific types
   05210 Colorectal cancer
    106980282
   05212 Pancreatic cancer
    106980282
   05225 Hepatocellular carcinoma
    106980282
   05226 Gastric cancer
    106980282
   05214 Glioma
    106980282
   05216 Thyroid cancer
    106980282
   05221 Acute myeloid leukemia
    106980282
   05220 Chronic myeloid leukemia
    106980282
   05218 Melanoma
    106980282
   05211 Renal cell carcinoma
    106980282
   05219 Bladder cancer
    106980282
   05215 Prostate cancer
    106980282
   05213 Endometrial cancer
    106980282
   05224 Breast cancer
    106980282
   05223 Non-small cell lung cancer
    106980282
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106980282
   05170 Human immunodeficiency virus 1 infection
    106980282
   05161 Hepatitis B
    106980282
   05160 Hepatitis C
    106980282
   05164 Influenza A
    106980282
   05163 Human cytomegalovirus infection
    106980282
   05167 Kaposi sarcoma-associated herpesvirus infection
    106980282
   05165 Human papillomavirus infection
    106980282
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106980282
   05135 Yersinia infection
    106980282
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106980282
   05022 Pathways of neurodegeneration - multiple diseases
    106980282
  09165 Substance dependence
   05034 Alcoholism
    106980282
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106980282
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106980282
   01522 Endocrine resistance
    106980282
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106980282
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106980282
Protein kinases [BR:aju01001]
 Serine/threonine kinases: STE group
  STE7 family
   106980282
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 106980282
NCBI-ProteinID: XP_014933772
UniProt: A0A6I9ZXA2
LinkDB
Position
B3:complement(38029268..38107417)
AA seq 371 aa
MKLERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVV
FKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYP
IPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPP
PKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDGEEVDFAGWLCSTIGLN
QPSTPTHAAGV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaagctggagaggaccaacctggaggccttgcagaagaagctggaggagctggagctc
gatgagcagcaacggaagcgcctggaggcctttcttacccagaagcagaaggtcggggaa
ttgaaggatgacgacttcgagaagatcagcgagctgggcgccggcaacggtggtgtggtg
ttcaaggtctcccataagccgtctggcctggtcatggccagaaagctaattcacctggag
atcaaacctgcaatccggaaccagatcataagggagctgcaggttctacatgagtgcaac
tccccatacatcgtgggcttctatggcgcgttctacagcgacggcgagatcagtatctgt
atggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaagaattcct
gaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacatacctgagggag
aagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactctcgtggg
gagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggccaactcc
ttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattactccgtg
cagtcggacatctggagcatggggctatctctggttgagatggcagtcgggaggtatccc
atccctcctcccgatgccaaggagctggagctgatgtttgggtgccaagtggagggagat
gcggctgagacgccacccaggccgaggacccctggaaggcccctcagctcgtatggaatg
gacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgagcctcct
ccaaagctgcccagtggagtattcagtctggaatttcaagattttgtgaataaatgcctc
ataaaaaacccagcagagagagcagatctgaaacaactcatggttcatgcctttatcaag
agatctgatggtgaggaagtggattttgcaggttggctctgctccaccatcggccttaac
cagcccagtacaccgacccacgcggccggcgtctaa

DBGET integrated database retrieval system