Acinonyx jubatus (cheetah): 106980413 Help Entry 106980413         CDS       T04657                                  Name (RefSeq) C-C motif chemokine 23   KO K05511   C-C motif chemokine 15/23 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04060   Cytokine-cytokine receptor interaction aju04061   Viral protein interaction with cytokine and cytokine receptor aju04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106980413    04061 Viral protein interaction with cytokine and cytokine receptor     106980413  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     106980413  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106980413 Cytokines and neuropeptides [BR:aju04052]  Cytokines   Chemokines    106980413 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  106980413 NCBI-ProteinID:  XP_014933896 UniProt:  A0A6J0A1E0 LinkDB All DBs Position E1:complement(22716773..22720838) Genome browser AA seq 107 aa AA seqDB search MKVFAAALPFLIVATAFGAQVQALHEPVAAIRPHETSIHLQGFHRPSDCCTHYTPRKIRC GFMEDYYETSSGCSQPGVIFLTKKGQRVCANPFDLGVQNCVRSLKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcttcgcagctgccctccccttcctcattgttgctactgcctttggagcccag gtccaggcccttcatgaacccgtggcggcaatacgtccgcatgaaacttcgatacatctg caaggctttcaccgtccctctgactgctgcacccactacactccacggaaaatccgatgt ggattcatggaagattactatgaaacaagcagcgggtgctcccagccaggtgtcatcttc ctcaccaagaaggggcagcgtgtctgtgccaacccctttgatttgggagttcagaattgc gtgaggtccctgaagtcgaactaa

DBGET integrated database retrieval system