Acinonyx jubatus (cheetah): 106981085 Help Entry 106981085         CDS       T04657                                  Name (RefSeq) dynein axonemal light chain 4   KO K10412   dynein axonemal light chain 4 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04814   Motor proteins aju05014   Amyotrophic lateral sclerosis aju05016   Huntington disease aju05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:aju00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     106981085  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106981085    05016 Huntington disease     106981085    05022 Pathways of neurodegeneration - multiple diseases     106981085  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:aju03037]     106981085    04812 Cytoskeleton proteins [BR:aju04812]     106981085 Cilium and associated proteins [BR:aju03037]  Motile cilia and associated proteins   Dynein arm    106981085 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      106981085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  106981085 NCBI-ProteinID:  XP_026926514 UniProt:  A0A6J2ADB6 LinkDB All DBs Position B4:complement(129911751..129923597) Genome browser AA seq 105 aa AA seqDB search MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKET MDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggagaaacagaagggaagaaagatgaggctgattataagcgactgcagaccttccct ctggtcaggcattcggacatgccagaggagatgcgagtagagaccatggagctatgtgtc acggcctgtgagaaattctccaacaacaatgagagcgctgccaagatgatcaaagagacg atggacaagaagttcggctcctcctggcacgtggtcatcggcgagggctttgggtttgag atcacacacgaggtgaagaacctcctgtacctgtacttcggggggaccctggctgtgtgt gtctggaagtgctcctga

DBGET integrated database retrieval system