Acinonyx jubatus (cheetah): 106986692 Help Entry 106986692         CDS       T04657                                  Name (RefSeq) profilin-4   KO K05759   profilin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04015   Rap1 signaling pathway aju04810   Regulation of actin cytoskeleton aju05014   Amyotrophic lateral sclerosis aju05132   Salmonella infection Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106986692  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106986692  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106986692   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106986692  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106986692   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:aju04812]     106986692    04147 Exosome [BR:aju04147]     106986692 Membrane trafficking [BR:aju04131]  Others   Actin-binding proteins    Others     106986692 Cytoskeleton proteins [BR:aju04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106986692 Exosome [BR:aju04147]  Exosomal proteins   Proteins found in most exosomes    106986692 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  106986692 NCBI-ProteinID:  XP_026889091 UniProt:  A0A6J1X9U9 LinkDB All DBs Position A3:119055851..119062603 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system