Acinonyx jubatus (cheetah): 106987075 Help Entry 106987075         CDS       T04657                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism aju  Acinonyx jubatus (cheetah) Pathway aju04022   cGMP-PKG signaling pathway aju04081   Hormone signaling aju04270   Vascular smooth muscle contraction aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     106987075   09133 Signaling molecules and interaction    04081 Hormone signaling     106987075  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     106987075  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106987075  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     106987075 Cytokines and neuropeptides [BR:aju04052]  Neuropeptides   Unclassified    106987075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  106987075 NCBI-ProteinID:  XP_026903623 UniProt:  A0A6J1YFV4 LinkDB All DBs Position C1:complement(210375907..210380671) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccaggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggtggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaggga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system