Acinonyx jubatus (cheetah): 106987957 Help Entry 106987957         CDS       T04657                                  Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism aju  Acinonyx jubatus (cheetah) Pathway aju01521   EGFR tyrosine kinase inhibitor resistance aju01522   Endocrine resistance aju04010   MAPK signaling pathway aju04012   ErbB signaling pathway aju04014   Ras signaling pathway aju04015   Rap1 signaling pathway aju04062   Chemokine signaling pathway aju04068   FoxO signaling pathway aju04071   Sphingolipid signaling pathway aju04072   Phospholipase D signaling pathway aju04137   Mitophagy - animal aju04140   Autophagy - animal aju04144   Endocytosis aju04150   mTOR signaling pathway aju04151   PI3K-Akt signaling pathway aju04210   Apoptosis aju04211   Longevity regulating pathway aju04213   Longevity regulating pathway - multiple species aju04218   Cellular senescence aju04360   Axon guidance aju04370   VEGF signaling pathway aju04371   Apelin signaling pathway aju04510   Focal adhesion aju04540   Gap junction aju04550   Signaling pathways regulating pluripotency of stem cells aju04625   C-type lectin receptor signaling pathway aju04630   JAK-STAT signaling pathway aju04650   Natural killer cell mediated cytotoxicity aju04660   T cell receptor signaling pathway aju04662   B cell receptor signaling pathway aju04664   Fc epsilon RI signaling pathway aju04714   Thermogenesis aju04720   Long-term potentiation aju04722   Neurotrophin signaling pathway aju04725   Cholinergic synapse aju04726   Serotonergic synapse aju04730   Long-term depression aju04810   Regulation of actin cytoskeleton aju04910   Insulin signaling pathway aju04912   GnRH signaling pathway aju04915   Estrogen signaling pathway aju04916   Melanogenesis aju04917   Prolactin signaling pathway aju04919   Thyroid hormone signaling pathway aju04921   Oxytocin signaling pathway aju04926   Relaxin signaling pathway aju04929   GnRH secretion aju04933   AGE-RAGE signaling pathway in diabetic complications aju04935   Growth hormone synthesis, secretion and action aju05010   Alzheimer disease aju05022   Pathways of neurodegeneration - multiple diseases aju05034   Alcoholism aju05132   Salmonella infection aju05160   Hepatitis C aju05161   Hepatitis B aju05163   Human cytomegalovirus infection aju05165   Human papillomavirus infection aju05166   Human T-cell leukemia virus 1 infection aju05167   Kaposi sarcoma-associated herpesvirus infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05203   Viral carcinogenesis aju05205   Proteoglycans in cancer aju05206   MicroRNAs in cancer aju05207   Chemical carcinogenesis - receptor activation aju05208   Chemical carcinogenesis - reactive oxygen species aju05210   Colorectal cancer aju05211   Renal cell carcinoma aju05213   Endometrial cancer aju05214   Glioma aju05215   Prostate cancer aju05216   Thyroid cancer aju05218   Melanoma aju05219   Bladder cancer aju05220   Chronic myeloid leukemia aju05221   Acute myeloid leukemia aju05223   Non-small cell lung cancer aju05224   Breast cancer aju05225   Hepatocellular carcinoma aju05226   Gastric cancer aju05230   Central carbon metabolism in cancer aju05231   Choline metabolism in cancer aju05235   PD-L1 expression and PD-1 checkpoint pathway in cancer aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106987957    04012 ErbB signaling pathway     106987957    04014 Ras signaling pathway     106987957    04015 Rap1 signaling pathway     106987957    04370 VEGF signaling pathway     106987957    04371 Apelin signaling pathway     106987957    04630 JAK-STAT signaling pathway     106987957    04068 FoxO signaling pathway     106987957    04072 Phospholipase D signaling pathway     106987957    04071 Sphingolipid signaling pathway     106987957    04151 PI3K-Akt signaling pathway     106987957    04150 mTOR signaling pathway     106987957  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106987957    04140 Autophagy - animal     106987957    04137 Mitophagy - animal     106987957   09143 Cell growth and death    04210 Apoptosis     106987957    04218 Cellular senescence     106987957   09144 Cellular community - eukaryotes    04510 Focal adhesion     106987957    04540 Gap junction     106987957    04550 Signaling pathways regulating pluripotency of stem cells     106987957   09142 Cell motility    04810 Regulation of actin cytoskeleton     106987957  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106987957    04650 Natural killer cell mediated cytotoxicity     106987957    04660 T cell receptor signaling pathway     106987957    04662 B cell receptor signaling pathway     106987957    04664 Fc epsilon RI signaling pathway     106987957    04062 Chemokine signaling pathway     106987957   09152 Endocrine system    04910 Insulin signaling pathway     106987957    04929 GnRH secretion     106987957    04912 GnRH signaling pathway     106987957    04915 Estrogen signaling pathway     106987957    04917 Prolactin signaling pathway     106987957    04921 Oxytocin signaling pathway     106987957    04926 Relaxin signaling pathway     106987957    04935 Growth hormone synthesis, secretion and action     106987957    04919 Thyroid hormone signaling pathway     106987957    04916 Melanogenesis     106987957   09156 Nervous system    04725 Cholinergic synapse     106987957    04726 Serotonergic synapse     106987957    04720 Long-term potentiation     106987957    04730 Long-term depression     106987957    04722 Neurotrophin signaling pathway     106987957   09158 Development and regeneration    04360 Axon guidance     106987957   09149 Aging    04211 Longevity regulating pathway     106987957    04213 Longevity regulating pathway - multiple species     106987957   09159 Environmental adaptation    04714 Thermogenesis     106987957  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106987957    05206 MicroRNAs in cancer     106987957    05205 Proteoglycans in cancer     106987957    05207 Chemical carcinogenesis - receptor activation     106987957    05208 Chemical carcinogenesis - reactive oxygen species     106987957    05203 Viral carcinogenesis     106987957    05230 Central carbon metabolism in cancer     106987957    05231 Choline metabolism in cancer     106987957    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     106987957   09162 Cancer: specific types    05210 Colorectal cancer     106987957    05225 Hepatocellular carcinoma     106987957    05226 Gastric cancer     106987957    05214 Glioma     106987957    05216 Thyroid cancer     106987957    05221 Acute myeloid leukemia     106987957    05220 Chronic myeloid leukemia     106987957    05218 Melanoma     106987957    05211 Renal cell carcinoma     106987957    05219 Bladder cancer     106987957    05215 Prostate cancer     106987957    05213 Endometrial cancer     106987957    05224 Breast cancer     106987957    05223 Non-small cell lung cancer     106987957   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106987957    05170 Human immunodeficiency virus 1 infection     106987957    05161 Hepatitis B     106987957    05160 Hepatitis C     106987957    05163 Human cytomegalovirus infection     106987957    05167 Kaposi sarcoma-associated herpesvirus infection     106987957    05165 Human papillomavirus infection     106987957   09171 Infectious disease: bacterial    05132 Salmonella infection     106987957   09164 Neurodegenerative disease    05010 Alzheimer disease     106987957    05022 Pathways of neurodegeneration - multiple diseases     106987957   09165 Substance dependence    05034 Alcoholism     106987957   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     106987957   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     106987957   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106987957    01522 Endocrine resistance     106987957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aju04131]     106987957   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106987957    04031 GTP-binding proteins [BR:aju04031]     106987957 Membrane trafficking [BR:aju04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     106987957  Endocytosis   Macropinocytosis    Ras GTPases     106987957 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106987957   Exosomal proteins of colorectal cancer cells    106987957 GTP-binding proteins [BR:aju04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106987957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  106987957 NCBI-ProteinID:  XP_026907169 UniProt:  A0A6J1YRL4 LinkDB All DBs Position D1:complement(331617..334722) Genome browser AA seq 191 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTPVTQRPLVLGWRTPSTRW SERSGNTRCGS NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctcgtggtggtgggcgctggaggtgtggggaagagtgccctgacc atccagctcatccagaaccacttcgtggacgagtatgaccccaccatcgaggactcctat cggaagcaagtggttattgatggcgagacgtgcctactggacattttggacacggcgggc caggaggagtatagcgccatgcgggaccagtacatgcgcactggagaaggcttcctctgt gtgtttgccatcaacaataccaagtcctttgaggacatccaccagtacagggagcaaatc aagcgagtgaaggactccgatgacgtgcccatggtgttggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtcccggcaggcgcaggaccttgcccgcagctacggcatcccg tacatcgagacgtcggccaagactcgccagggcagccgctctggctctggctccagctcc gggacccccgtgacccagcggcccctagtgctggggtggaggacgccttctacacgctgg tccgagagatccggcaacacaaggtgcggaagctga

DBGET integrated database retrieval system