KEGG   Acinonyx jubatus (cheetah): 106987957
Entry
106987957         CDS       T04657                                 
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju04010  MAPK signaling pathway
aju04012  ErbB signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04062  Chemokine signaling pathway
aju04068  FoxO signaling pathway
aju04071  Sphingolipid signaling pathway
aju04072  Phospholipase D signaling pathway
aju04137  Mitophagy - animal
aju04140  Autophagy - animal
aju04144  Endocytosis
aju04150  mTOR signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04211  Longevity regulating pathway
aju04213  Longevity regulating pathway - multiple species
aju04218  Cellular senescence
aju04360  Axon guidance
aju04370  VEGF signaling pathway
aju04371  Apelin signaling pathway
aju04510  Focal adhesion
aju04540  Gap junction
aju04550  Signaling pathways regulating pluripotency of stem cells
aju04625  C-type lectin receptor signaling pathway
aju04630  JAK-STAT signaling pathway
aju04650  Natural killer cell mediated cytotoxicity
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04664  Fc epsilon RI signaling pathway
aju04714  Thermogenesis
aju04720  Long-term potentiation
aju04722  Neurotrophin signaling pathway
aju04725  Cholinergic synapse
aju04726  Serotonergic synapse
aju04730  Long-term depression
aju04810  Regulation of actin cytoskeleton
aju04910  Insulin signaling pathway
aju04912  GnRH signaling pathway
aju04915  Estrogen signaling pathway
aju04916  Melanogenesis
aju04917  Prolactin signaling pathway
aju04919  Thyroid hormone signaling pathway
aju04921  Oxytocin signaling pathway
aju04926  Relaxin signaling pathway
aju04929  GnRH secretion
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju04935  Growth hormone synthesis, secretion and action
aju05010  Alzheimer disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05034  Alcoholism
aju05132  Salmonella infection
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05163  Human cytomegalovirus infection
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05205  Proteoglycans in cancer
aju05206  MicroRNAs in cancer
aju05207  Chemical carcinogenesis - receptor activation
aju05208  Chemical carcinogenesis - reactive oxygen species
aju05210  Colorectal cancer
aju05211  Renal cell carcinoma
aju05213  Endometrial cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05216  Thyroid cancer
aju05218  Melanoma
aju05219  Bladder cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
aju05230  Central carbon metabolism in cancer
aju05231  Choline metabolism in cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aju05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106987957
   04012 ErbB signaling pathway
    106987957
   04014 Ras signaling pathway
    106987957
   04015 Rap1 signaling pathway
    106987957
   04370 VEGF signaling pathway
    106987957
   04371 Apelin signaling pathway
    106987957
   04630 JAK-STAT signaling pathway
    106987957
   04068 FoxO signaling pathway
    106987957
   04072 Phospholipase D signaling pathway
    106987957
   04071 Sphingolipid signaling pathway
    106987957
   04151 PI3K-Akt signaling pathway
    106987957
   04150 mTOR signaling pathway
    106987957
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106987957
   04140 Autophagy - animal
    106987957
   04137 Mitophagy - animal
    106987957
  09143 Cell growth and death
   04210 Apoptosis
    106987957
   04218 Cellular senescence
    106987957
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106987957
   04540 Gap junction
    106987957
   04550 Signaling pathways regulating pluripotency of stem cells
    106987957
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106987957
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106987957
   04650 Natural killer cell mediated cytotoxicity
    106987957
   04660 T cell receptor signaling pathway
    106987957
   04662 B cell receptor signaling pathway
    106987957
   04664 Fc epsilon RI signaling pathway
    106987957
   04062 Chemokine signaling pathway
    106987957
  09152 Endocrine system
   04910 Insulin signaling pathway
    106987957
   04929 GnRH secretion
    106987957
   04912 GnRH signaling pathway
    106987957
   04915 Estrogen signaling pathway
    106987957
   04917 Prolactin signaling pathway
    106987957
   04921 Oxytocin signaling pathway
    106987957
   04926 Relaxin signaling pathway
    106987957
   04935 Growth hormone synthesis, secretion and action
    106987957
   04919 Thyroid hormone signaling pathway
    106987957
   04916 Melanogenesis
    106987957
  09156 Nervous system
   04725 Cholinergic synapse
    106987957
   04726 Serotonergic synapse
    106987957
   04720 Long-term potentiation
    106987957
   04730 Long-term depression
    106987957
   04722 Neurotrophin signaling pathway
    106987957
  09158 Development and regeneration
   04360 Axon guidance
    106987957
  09149 Aging
   04211 Longevity regulating pathway
    106987957
   04213 Longevity regulating pathway - multiple species
    106987957
  09159 Environmental adaptation
   04714 Thermogenesis
    106987957
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106987957
   05206 MicroRNAs in cancer
    106987957
   05205 Proteoglycans in cancer
    106987957
   05207 Chemical carcinogenesis - receptor activation
    106987957
   05208 Chemical carcinogenesis - reactive oxygen species
    106987957
   05203 Viral carcinogenesis
    106987957
   05230 Central carbon metabolism in cancer
    106987957
   05231 Choline metabolism in cancer
    106987957
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106987957
  09162 Cancer: specific types
   05210 Colorectal cancer
    106987957
   05225 Hepatocellular carcinoma
    106987957
   05226 Gastric cancer
    106987957
   05214 Glioma
    106987957
   05216 Thyroid cancer
    106987957
   05221 Acute myeloid leukemia
    106987957
   05220 Chronic myeloid leukemia
    106987957
   05218 Melanoma
    106987957
   05211 Renal cell carcinoma
    106987957
   05219 Bladder cancer
    106987957
   05215 Prostate cancer
    106987957
   05213 Endometrial cancer
    106987957
   05224 Breast cancer
    106987957
   05223 Non-small cell lung cancer
    106987957
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106987957
   05170 Human immunodeficiency virus 1 infection
    106987957
   05161 Hepatitis B
    106987957
   05160 Hepatitis C
    106987957
   05163 Human cytomegalovirus infection
    106987957
   05167 Kaposi sarcoma-associated herpesvirus infection
    106987957
   05165 Human papillomavirus infection
    106987957
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106987957
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106987957
   05022 Pathways of neurodegeneration - multiple diseases
    106987957
  09165 Substance dependence
   05034 Alcoholism
    106987957
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    106987957
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106987957
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106987957
   01522 Endocrine resistance
    106987957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106987957
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106987957
   04031 GTP-binding proteins [BR:aju04031]
    106987957
Membrane trafficking [BR:aju04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    106987957
 Endocytosis
  Macropinocytosis
   Ras GTPases
    106987957
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106987957
  Exosomal proteins of colorectal cancer cells
   106987957
GTP-binding proteins [BR:aju04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    106987957
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N DUF6974
Other DBs
NCBI-GeneID: 106987957
NCBI-ProteinID: XP_026907169
UniProt: A0A6J1YRL4
LinkDB
Position
D1:complement(331617..334722)
AA seq 191 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTPVTQRPLVLGWRTPSTRW
SERSGNTRCGS
NT seq 576 nt   +upstreamnt  +downstreamnt
atgacggaatataagctcgtggtggtgggcgctggaggtgtggggaagagtgccctgacc
atccagctcatccagaaccacttcgtggacgagtatgaccccaccatcgaggactcctat
cggaagcaagtggttattgatggcgagacgtgcctactggacattttggacacggcgggc
caggaggagtatagcgccatgcgggaccagtacatgcgcactggagaaggcttcctctgt
gtgtttgccatcaacaataccaagtcctttgaggacatccaccagtacagggagcaaatc
aagcgagtgaaggactccgatgacgtgcccatggtgttggtggggaacaagtgtgacctg
gccgcgcgcaccgtggagtcccggcaggcgcaggaccttgcccgcagctacggcatcccg
tacatcgagacgtcggccaagactcgccagggcagccgctctggctctggctccagctcc
gggacccccgtgacccagcggcccctagtgctggggtggaggacgccttctacacgctgg
tccgagagatccggcaacacaaggtgcggaagctga

DBGET integrated database retrieval system