Acinonyx jubatus (cheetah): 106988077 Help Entry 106988077         CDS       T04657                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04613   Neutrophil extracellular trap formation aju05034   Alcoholism aju05203   Viral carcinogenesis aju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106988077  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106988077   09163 Immune disease    05322 Systemic lupus erythematosus     106988077   09165 Substance dependence    05034 Alcoholism     106988077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     106988077 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106988077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  106988077 NCBI-ProteinID:  XP_014941950 UniProt:  A0A6J1XTQ6 LinkDB All DBs Position B2:complement(146016354..146016764) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgaggcaaaggcgggaagggtctgggcaaagggggcgctaagcgccatcgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system