KEGG   Acinonyx jubatus (cheetah): 106988135
Entry
106988135         CDS       T04657                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04020  Calcium signaling pathway
aju04022  cGMP-PKG signaling pathway
aju04024  cAMP signaling pathway
aju04070  Phosphatidylinositol signaling system
aju04114  Oocyte meiosis
aju04218  Cellular senescence
aju04261  Adrenergic signaling in cardiomyocytes
aju04270  Vascular smooth muscle contraction
aju04371  Apelin signaling pathway
aju04625  C-type lectin receptor signaling pathway
aju04713  Circadian entrainment
aju04720  Long-term potentiation
aju04722  Neurotrophin signaling pathway
aju04728  Dopaminergic synapse
aju04740  Olfactory transduction
aju04744  Phototransduction
aju04750  Inflammatory mediator regulation of TRP channels
aju04910  Insulin signaling pathway
aju04912  GnRH signaling pathway
aju04915  Estrogen signaling pathway
aju04916  Melanogenesis
aju04921  Oxytocin signaling pathway
aju04922  Glucagon signaling pathway
aju04924  Renin secretion
aju04925  Aldosterone synthesis and secretion
aju04970  Salivary secretion
aju04971  Gastric acid secretion
aju05010  Alzheimer disease
aju05012  Parkinson disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05031  Amphetamine addiction
aju05034  Alcoholism
aju05133  Pertussis
aju05152  Tuberculosis
aju05163  Human cytomegalovirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05214  Glioma
aju05417  Lipid and atherosclerosis
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106988135
   04015 Rap1 signaling pathway
    106988135
   04371 Apelin signaling pathway
    106988135
   04020 Calcium signaling pathway
    106988135
   04070 Phosphatidylinositol signaling system
    106988135
   04024 cAMP signaling pathway
    106988135
   04022 cGMP-PKG signaling pathway
    106988135
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106988135
   04218 Cellular senescence
    106988135
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106988135
  09152 Endocrine system
   04910 Insulin signaling pathway
    106988135
   04922 Glucagon signaling pathway
    106988135
   04912 GnRH signaling pathway
    106988135
   04915 Estrogen signaling pathway
    106988135
   04921 Oxytocin signaling pathway
    106988135
   04916 Melanogenesis
    106988135
   04924 Renin secretion
    106988135
   04925 Aldosterone synthesis and secretion
    106988135
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106988135
   04270 Vascular smooth muscle contraction
    106988135
  09154 Digestive system
   04970 Salivary secretion
    106988135
   04971 Gastric acid secretion
    106988135
  09156 Nervous system
   04728 Dopaminergic synapse
    106988135
   04720 Long-term potentiation
    106988135
   04722 Neurotrophin signaling pathway
    106988135
  09157 Sensory system
   04744 Phototransduction
    106988135
   04740 Olfactory transduction
    106988135
   04750 Inflammatory mediator regulation of TRP channels
    106988135
  09159 Environmental adaptation
   04713 Circadian entrainment
    106988135
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988135
  09162 Cancer: specific types
   05214 Glioma
    106988135
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106988135
   05163 Human cytomegalovirus infection
    106988135
   05167 Kaposi sarcoma-associated herpesvirus infection
    106988135
  09171 Infectious disease: bacterial
   05133 Pertussis
    106988135
   05152 Tuberculosis
    106988135
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106988135
   05012 Parkinson disease
    106988135
   05022 Pathways of neurodegeneration - multiple diseases
    106988135
  09165 Substance dependence
   05031 Amphetamine addiction
    106988135
   05034 Alcoholism
    106988135
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    106988135
   05418 Fluid shear stress and atherosclerosis
    106988135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106988135
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aju04131]
    106988135
   03036 Chromosome and associated proteins [BR:aju03036]
    106988135
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106988135
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     106988135
Membrane trafficking [BR:aju04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    106988135
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     106988135
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106988135
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EF-hand_FSTL1 Allatotropin-like_C SPARC_Ca_bdg EH Dockerin_1 CFAP251_C UPF0154 EF-hand_EFHB_C EF_EFCAB10_C EF-hand_STIM1 SAPC2_N ExbD SurA_N_3 DUF5580_M SCO1-SenC ERAP1_C HsdM_C DUF6772 SurA_N_2
Other DBs
NCBI-GeneID: 106988135
NCBI-ProteinID: XP_026929128
UniProt: A0A6J2AIA0
LinkDB
Position
B4:complement(4632419..4633683)
AA seq 149 aa
MAEQLSKEQVAEFKEAFTSFDKDGDGKIDVQELGAVMQALGENPSEAELKQLIARVDTDG
DGHISFDEFLAVMAEIMKSSGSEAEMREVFRAFDLDGDGHISVNELKQAMAKLGENPSQE
ELDAMIQGADVDQDGQVNYEEFVRILSQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcggagcagctgtctaaagaacaggtggccgagttcaaggaggccttcaccagtttt
gacaaggacggggatggaaagatcgacgtccaggagctgggtgccgtgatgcaggccctg
ggcgagaacccgtcggaagccgagctgaagcagctcatcgcccgggtggacaccgatggc
gacggccacatcagcttcgacgagttcctggcagtgatggccgagatcatgaagtcctcg
ggcagcgaggcggagatgcgggaagtcttccgtgccttcgacctggacggcgacggccac
atcagcgtcaacgagctcaagcaggccatggccaagctgggcgagaatccttcccaggag
gagctggacgccatgatccagggcgccgacgtggaccaggacgggcaagtgaactacgag
gagttcgtgcgcatcctctctcagaagtga

DBGET integrated database retrieval system