Acinonyx jubatus (cheetah): 106989350 Help Entry 106989350         CDS       T04657                                  Name (RefSeq) histone H2B type 1-A   KO K11252   histone H2B Organism aju  Acinonyx jubatus (cheetah) Pathway aju04613   Neutrophil extracellular trap formation aju05034   Alcoholism aju05203   Viral carcinogenesis aju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106989350  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106989350   09163 Immune disease    05322 Systemic lupus erythematosus     106989350   09165 Substance dependence    05034 Alcoholism     106989350  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     106989350   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     106989350 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106989350 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106989350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 CvfB_WH Motif Other DBs NCBI-GeneID:  106989350 NCBI-ProteinID:  XP_014943328 UniProt:  A0A6J0A8U3 LinkDB All DBs Position B2:145554920..145895600 Genome browser AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKKAVTKTQKKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgacttccaagggcacgaccatttccaagaaaggcttcaaaaaagctgta accaaaacccagaagaaggaaggcaagaagcgcaagcgatgccgcaaggagagctattcc atttacatctacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggct atgagcatcatgaactctttcgtcactgacatcttcgagcgcatcgcgggcgaggcgtcg cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtag

DBGET integrated database retrieval system