Acinonyx jubatus (cheetah): 113593971 Help Entry 113593971         CDS       T04657                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism aju  Acinonyx jubatus (cheetah) Pathway aju04613   Neutrophil extracellular trap formation aju05034   Alcoholism aju05203   Viral carcinogenesis aju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     113593971  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     113593971   09163 Immune disease    05322 Systemic lupus erythematosus     113593971   09165 Substance dependence    05034 Alcoholism     113593971  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     113593971   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     113593971 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113593971 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113593971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  113593971 NCBI-ProteinID:  XP_026896263 UniProt:  A0A6J1XU00 LinkDB All DBs Position B2:146910721..146911186 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccagccaagtccgccccggccccgaagaagggctcgaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system