Acinonyx jubatus (cheetah): 113595531 Help Entry 113595531         CDS       T04657                                  Name (RefSeq) insulin   KO K04526   insulin Organism aju  Acinonyx jubatus (cheetah) Pathway aju04010   MAPK signaling pathway aju04014   Ras signaling pathway aju04015   Rap1 signaling pathway aju04022   cGMP-PKG signaling pathway aju04066   HIF-1 signaling pathway aju04068   FoxO signaling pathway aju04072   Phospholipase D signaling pathway aju04081   Hormone signaling aju04114   Oocyte meiosis aju04140   Autophagy - animal aju04150   mTOR signaling pathway aju04151   PI3K-Akt signaling pathway aju04152   AMPK signaling pathway aju04211   Longevity regulating pathway aju04213   Longevity regulating pathway - multiple species aju04810   Regulation of actin cytoskeleton aju04910   Insulin signaling pathway aju04911   Insulin secretion aju04913   Ovarian steroidogenesis aju04914   Progesterone-mediated oocyte maturation aju04917   Prolactin signaling pathway aju04923   Regulation of lipolysis in adipocytes aju04930   Type II diabetes mellitus aju04931   Insulin resistance aju04932   Non-alcoholic fatty liver disease aju04940   Type I diabetes mellitus aju04950   Maturity onset diabetes of the young aju04960   Aldosterone-regulated sodium reabsorption aju05010   Alzheimer disease aju05215   Prostate cancer aju05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113595531    04014 Ras signaling pathway     113595531    04015 Rap1 signaling pathway     113595531    04066 HIF-1 signaling pathway     113595531    04068 FoxO signaling pathway     113595531    04072 Phospholipase D signaling pathway     113595531    04022 cGMP-PKG signaling pathway     113595531    04151 PI3K-Akt signaling pathway     113595531    04152 AMPK signaling pathway     113595531    04150 mTOR signaling pathway     113595531   09133 Signaling molecules and interaction    04081 Hormone signaling     113595531  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113595531   09143 Cell growth and death    04114 Oocyte meiosis     113595531   09142 Cell motility    04810 Regulation of actin cytoskeleton     113595531  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     113595531    04910 Insulin signaling pathway     113595531    04923 Regulation of lipolysis in adipocytes     113595531    04913 Ovarian steroidogenesis     113595531    04914 Progesterone-mediated oocyte maturation     113595531    04917 Prolactin signaling pathway     113595531   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     113595531   09149 Aging    04211 Longevity regulating pathway     113595531    04213 Longevity regulating pathway - multiple species     113595531  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     113595531   09164 Neurodegenerative disease    05010 Alzheimer disease     113595531   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     113595531   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     113595531    04940 Type I diabetes mellitus     113595531    04950 Maturity onset diabetes of the young     113595531    04932 Non-alcoholic fatty liver disease     113595531    04931 Insulin resistance     113595531  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aju04052]     113595531 Cytokines and neuropeptides [BR:aju04052]  Neuropeptides   Unclassified    113595531 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  113595531 NCBI-ProteinID:  XP_026901706 UniProt:  A0A6J1Y9M9 LinkDB All DBs Position D1:complement(1687622..1688589) Genome browser AA seq 110 aa AA seqDB search MALWTRLLPLLALLSLWTPAPTRAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAED LQGKDAELGEAPGAGGLQPSALEAPLQKRGIVEQCCASVCSLYQLEHYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctggcgttgctgtccctctggacccctgcc ccgacccgagccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac ctggtgtgcggggagcgcggcttcttctacacgcccaaggcccgccgggaggcagaggac cttcaggggaaggacgcggagctgggggaggcgcctggcgcgggcggcctgcagccctcg gccctggaggcgcccctgcagaagcggggcatcgtggagcaatgctgtgccagtgtctgc tcgctgtaccagctggagcattactgcaactag

DBGET integrated database retrieval system