Acinonyx jubatus (cheetah): 128315722 Help Entry 128315722         CDS       T04657                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism aju  Acinonyx jubatus (cheetah) Pathway aju04613   Neutrophil extracellular trap formation aju05034   Alcoholism aju05202   Transcriptional misregulation in cancer aju05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:aju00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     128315722  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     128315722   09163 Immune disease    05322 Systemic lupus erythematosus     128315722   09165 Substance dependence    05034 Alcoholism     128315722  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     128315722   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aju04147]     128315722 Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128315722 Exosome [BR:aju04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128315722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  128315722 NCBI-ProteinID:  XP_053079216 UniProt:  A0A6J0A779 LinkDB All DBs Position B2:145800084..145800565 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

DBGET integrated database retrieval system