Acinonyx jubatus (cheetah): 128316364 Help Entry 128316364         CDS       T04657                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism aju  Acinonyx jubatus (cheetah) Pathway aju00190   Oxidative phosphorylation aju01100   Metabolic pathways aju01524   Platinum drug resistance aju04115   p53 signaling pathway aju04210   Apoptosis aju04215   Apoptosis - multiple species aju04932   Non-alcoholic fatty liver disease aju05010   Alzheimer disease aju05012   Parkinson disease aju05014   Amyotrophic lateral sclerosis aju05016   Huntington disease aju05017   Spinocerebellar ataxia aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05132   Salmonella infection aju05134   Legionellosis aju05145   Toxoplasmosis aju05152   Tuberculosis aju05160   Hepatitis C aju05161   Hepatitis B aju05162   Measles aju05163   Human cytomegalovirus infection aju05164   Influenza A aju05167   Kaposi sarcoma-associated herpesvirus infection aju05168   Herpes simplex virus 1 infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05210   Colorectal cancer aju05222   Small cell lung cancer aju05416   Viral myocarditis aju05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     128316364  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     128316364    04215 Apoptosis - multiple species     128316364    04115 p53 signaling pathway     128316364  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     128316364   09162 Cancer: specific types    05210 Colorectal cancer     128316364    05222 Small cell lung cancer     128316364   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     128316364    05161 Hepatitis B     128316364    05160 Hepatitis C     128316364    05164 Influenza A     128316364    05162 Measles     128316364    05168 Herpes simplex virus 1 infection     128316364    05163 Human cytomegalovirus infection     128316364    05167 Kaposi sarcoma-associated herpesvirus infection     128316364    05169 Epstein-Barr virus infection     128316364   09171 Infectious disease: bacterial    05132 Salmonella infection     128316364    05134 Legionellosis     128316364    05152 Tuberculosis     128316364   09174 Infectious disease: parasitic    05145 Toxoplasmosis     128316364   09164 Neurodegenerative disease    05010 Alzheimer disease     128316364    05012 Parkinson disease     128316364    05014 Amyotrophic lateral sclerosis     128316364    05016 Huntington disease     128316364    05017 Spinocerebellar ataxia     128316364    05020 Prion disease     128316364    05022 Pathways of neurodegeneration - multiple diseases     128316364   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     128316364    05416 Viral myocarditis     128316364   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     128316364   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     128316364 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG NCKAP5 Motif Other DBs NCBI-GeneID:  128316364 NCBI-ProteinID:  XP_053081949 LinkDB All DBs Position B4:complement(53439573..53449546) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVETGGKHNTGPNLHGLFGRKTGQAPGFSYMDASKNKGITW GEETLMEYLENPKKYIPGTKMIFTGIKKAGERADLIAYLKKATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact gtggaaacgggaggcaagcacaacactgggccaaatctccatggtttatttgggcgaaag acaggtcaagcccctggattttcttacatggatgccagcaagaacaaaggcatcacctgg ggagaggagacactgatggagtatttggaaaatcccaagaagtacatccctggaacaaaa atgatcttcactggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa aaagctactaaggagtaa

DBGET integrated database retrieval system