Acinonyx jubatus (cheetah): 2654022 Help Entry 2654022           CDS       T04657                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism aju  Acinonyx jubatus (cheetah) Pathway aju00190   Oxidative phosphorylation aju01100   Metabolic pathways aju04714   Thermogenesis aju04723   Retrograde endocannabinoid signaling aju05010   Alzheimer disease aju05012   Parkinson disease aju05014   Amyotrophic lateral sclerosis aju05016   Huntington disease aju05020   Prion disease aju05022   Pathways of neurodegeneration - multiple diseases aju05208   Chemical carcinogenesis - reactive oxygen species aju05415   Diabetic cardiomyopathy Module aju_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:aju00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     2654022 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     2654022 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     2654022 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     2654022 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     2654022 (ND3)    05012 Parkinson disease     2654022 (ND3)    05014 Amyotrophic lateral sclerosis     2654022 (ND3)    05016 Huntington disease     2654022 (ND3)    05020 Prion disease     2654022 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     2654022 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     2654022 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:aju03029]     2654022 (ND3) Enzymes [BR:aju01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      2654022 (ND3) Mitochondrial biogenesis [BR:aju03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     2654022 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  2654022 NCBI-ProteinID:  NP_941385 UniProt:  Q71RU6 LinkDB All DBs Position MT Genome browser AA seq 115 aa AA seqDB search MNIMLALLTNTLLSTLLVLIAFWLPQLNIYAEKVSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTNNLPTMLTMALMLISLLAVSLAYEWTQKGLEWTE NT seq 346 nt NT seq  +upstreamnt  +downstreamnt ataaacattatactcgccctactcactaacacgctcctatccacactacttgtacttatc gcattttgactgccccaactgaatatttacgcagaaaaagtaagcccctatgagtgcgga tttgaccctataggatctgcccgtttgcccttttccatgaaattcttcctagtagccatc acattcctgctatttgacctagaaattgccctactactcccccttccctgagcctcacaa acgaataatctaccaactatactcaccatagcccttatactgatctcactattagctgta agcctagcctatgaatgaacccaaaaaggattagaatgaactgaat

DBGET integrated database retrieval system