KEGG   Advenella kashmirensis: TKWG_08890
Entry
TKWG_08890        CDS       T02117                                 
Name
(GenBank) winged helix family two component transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
aka  Advenella kashmirensis
Brite
KEGG Orthology (KO) [BR:aka00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aka02022]
    TKWG_08890
Two-component system [BR:aka02022]
 OmpR family
  Unclassified
   TKWG_08890
SSDB
Motif
Pfam: Response_reg Trans_reg_C
Other DBs
NCBI-ProteinID: AFK62122
UniProt: I3UAT4
LinkDB
Position
complement(1533072..1533773)
AA seq 233 aa
MNIAKVLLIEDDPRIISFLEKGLRAEGYDVDVSRDGLHGYETARDGDFDLIVLDVMLPKL
EGIEVCSRLRADGCQSMILMLTAKAELHDRITGLNRGADDYLTKPFAFDELVARMQALLR
RGQQKRRSTMLLQVGNLQLDFRTKTAQRGQRRIELTAKEFALLAYLMEHAGIVVSRAQLL
RDVWRMDFDPGTKVVDVYIRYLRSKIEHEGEPPLLHTARGFGYMINVEEKDIM
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaatatagccaaggtactattgattgaagatgatccacgtattatttcgtttctggag
aaaggtctgcgggctgaaggttatgatgtcgacgtgtcccgcgacggtctgcatggttac
gagacagcacgcgatggagatttcgatttgattgttttggacgtcatgctgccgaaactg
gaagggatcgaagtctgctcgcgattacgggcagatggctgccaaagcatgatcctgatg
ctgaccgccaaagctgaattgcatgatcgcatcaccggtttaaaccggggcgccgatgat
tatctgacgaaaccgtttgcttttgacgaattggttgcacgtatgcaggcgctgctgcgt
cgcggtcagcaaaagcgacgctcaacgatgctgctgcaagtaggaaatctgcaactcgac
ttccgcaccaagacggcgcaacgcggacaacggcgcatcgagcttacagccaaagaattc
gccctgctcgcgtacctgatggaacatgccggcatcgttgtcagccgagcccagttgctg
cgtgacgtttggcgtatggatttcgatccgggcaccaaagtggtcgatgtgtatatccgc
tatctgcgatcaaaaatcgaacacgaaggcgagccaccactgctgcacacagcaagaggg
tttggttatatgatcaatgttgaggaaaaggatattatgtga

DBGET integrated database retrieval system