Advenella kashmirensis: TKWG_09870 Help Entry TKWG_09870        CDS       T02117                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aka  Advenella kashmirensis Pathway aka01100   Metabolic pathways aka01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aka00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TKWG_09870 (acpP)    00074 Mycolic acid biosynthesis     TKWG_09870 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TKWG_09870 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1896 Ribosomal_L50 HLH DUF1493 EutQ Motif Other DBs NCBI-ProteinID:  AFK62264 UniProt:  I3UB76 LinkDB All DBs Position 1712498..1712734 Genome browser AA seq 78 aa AA seqDB search MDSIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAVDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggatagcatcgaacaacgcgtcaagaagatcgtcgcagaacaacttggtgtaaatgaa gcagaaattaaaaacgagtcttcatttcttgacgacctgggtgcagattcactggacatg gttgagttggtcatggcacttgaagacgagttcgaaacagaaattcctgacgaagaagct gaaaaaatcacaactgttcagcaggcagtcgactatatcaactctcacaaaggttaa

DBGET integrated database retrieval system