Advenella kashmirensis: TKWG_24985 Help Entry TKWG_24985        CDS       T02117                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aka  Advenella kashmirensis Pathway aka01100   Metabolic pathways aka01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aka00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TKWG_24985    00074 Mycolic acid biosynthesis     TKWG_24985   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TKWG_24985 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  AFK64542 UniProt:  I3UHQ4 LinkDB All DBs Position 4286540..4286791 Genome browser AA seq 83 aa AA seqDB search MNPSDHIYQTLKTALVELFEIEPERIRPDADLYTDLNIDSIDAIDLIDHIKRVTGHKLLA EDFRSVRTVQDVVDAVIRKLAPA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaatccatcagaccatatttatcagacgctcaagactgcactggtagagctgtttgaa attgaacccgagcgtatccggcctgatgccgatctgtacactgatctgaatatcgacagc atcgacgccatcgatctgatagaccatatcaaacgcgtcaccggccacaagctgctggca gaagatttccgcagcgtgcgcacagtgcaggatgtcgttgatgccgtaattcgtaaactt gctcctgcataa

DBGET integrated database retrieval system