Arthrobacter koreensis: N9A08_09240 Help Entry N9A08_09240       CDS       T09441                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism ako  Arthrobacter koreensis Brite KEGG Orthology (KO) [BR:ako00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     N9A08_09240 Enzymes [BR:ako01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      N9A08_09240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 GST_N_3 Thioredoxin_7 Glrx-like DUF3088 Thioredoxin_9 Motif Other DBs NCBI-ProteinID:  UYB34841 LinkDB All DBs Position 2011899..2012171 Genome browser AA seq 90 aa AA seqDB search MSATAEAFTPDAGTITMFSTSWCGYCRRLKSQLDSAGIGYTEVNIEDTEGTAELVESLNG GNQTVPTVIFPDGSAATNPSAAEVKSRLGL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtccgccacagccgaagcattcactcccgacgccggaaccatcaccatgttttcaacc agctggtgcgggtactgccgccggctgaagtcccagctggattcggcgggaatcggctat accgaggtgaacatcgaggacaccgaaggaaccgccgagctggtggaatccctgaacggc ggcaaccagaccgttcccaccgtgatcttccccgacggctccgctgcgacgaacccctcc gccgccgaggtgaagtcccgtctgggcctgtga

DBGET integrated database retrieval system