Arthrobacter koreensis: N9A08_14155 Help Entry N9A08_14155       CDS       T09441                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ako  Arthrobacter koreensis Brite KEGG Orthology (KO) [BR:ako00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ako03032]     N9A08_14155    03036 Chromosome and associated proteins [BR:ako03036]     N9A08_14155    03400 DNA repair and recombination proteins [BR:ako03400]     N9A08_14155 DNA replication proteins [BR:ako03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     N9A08_14155 Chromosome and associated proteins [BR:ako03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     N9A08_14155 DNA repair and recombination proteins [BR:ako03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       N9A08_14155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  UYB35741 LinkDB All DBs Position complement(3054129..3054407) Genome browser AA seq 92 aa AA seqDB search MNRSELVAAVAEKSGNSQTAVNGVLDAVFDIFATSVANGEKITIPGWLAVERTDRAARQG RNPQTGETIQIPAGHSVKLTAGSKLKAAVAKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgaacttgttgccgctgtcgcagagaagtccggcaacagccagaccgcc gttaacggcgtgctcgacgctgtcttcgacatcttcgccacttccgttgccaacggcgaa aagatcaccatcccgggctggcttgctgttgagcgcaccgaccgtgcagctcgccagggc cgcaacccgcagaccggcgaaaccatccagatcccggccggccacagcgtcaagctgacc gcaggctccaagctgaaggctgctgtcgccaagaagtag

DBGET integrated database retrieval system