Apis laboriosa (Himalayan honeybee): 122714437 Help Entry 122714437         CDS       T07817                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism alab  Apis laboriosa (Himalayan honeybee) Pathway alab04013   MAPK signaling pathway - fly alab04145   Phagosome alab04148   Efferocytosis alab04310   Wnt signaling pathway alab04620   Toll-like receptor signaling pathway alab05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:alab00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     122714437    04310 Wnt signaling pathway     122714437  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122714437    04148 Efferocytosis     122714437  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122714437  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122714437  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:alab04131]     122714437   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:alab04147]     122714437    04031 GTP-binding proteins [BR:alab04031]     122714437 Membrane trafficking [BR:alab04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122714437  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122714437   Macropinocytosis    Ras GTPases     122714437  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122714437 Exosome [BR:alab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122714437   Exosomal proteins of other body fluids (saliva and urine)    122714437   Exosomal proteins of colorectal cancer cells    122714437   Exosomal proteins of bladder cancer cells    122714437 GTP-binding proteins [BR:alab04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122714437 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  122714437 NCBI-ProteinID:  XP_043791692 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctattaaatgtgttgtcgtaggagacggagcagtaggtaaaacatgtctcctt ataagctacactaccaatgcctttcctggagaatatattccaactgtatttgacaattat tctgcaaatgtcatggtggatggtaaaccaataaatcttggtttatgggatacagcaggt caagaagattatgacagattaagaccattgtcttatcctcaaacagatgtttttttgatc tgcttttctctcgttaacccagccagttttgaaaatgttcgtgcaaaatggtatccagaa gtacgtcatcattgtccagctactccaattattttagtaggaactaaattagatttacgc gaagataaagaaacaattgagcgattaaaagataagaaacttgcaccaataacatatcct cagggtttatccatggcaaaagaaattggtgctgtaaaatatttagaatgttcggctctt actcaaaaaggattaaaaacagtatttgatgaagcaattcgcgcagtattgtgtcctgtt cttcaagtgaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system