Apis laboriosa (Himalayan honeybee): 122717451 Help Entry 122717451         CDS       T07817                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism alab  Apis laboriosa (Himalayan honeybee) Pathway alab04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:alab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122717451  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:alab04121]     122717451    03400 DNA repair and recombination proteins [BR:alab03400]     122717451 Ubiquitin system [BR:alab04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      122717451    Cul5 complex      122717451 DNA repair and recombination proteins [BR:alab03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122717451 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Lin1244_N Motif Other DBs NCBI-GeneID:  122717451 NCBI-ProteinID:  XP_043797462 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MDVFLMIRRKNMTIFTDAKDNTTVLELKKIIEGILKISPVNQQLFNKDNVLMSDSKFLSD YGLTSATAKPQCPALVGLAIRQDNGQFEPLEMTPFSLPPDLPDVMKSQETNGQEQSP NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgattcgacgaaaaaatatgacaatatttactgacgctaaggat aatactacagttcttgaacttaaaaaaattatagaaggtatattgaaaatatcacctgtg aatcaacagctgttcaacaaggataatgttcttatgtcagatagtaaatttttatctgat tatggattaacatcagcaactgcaaaaccacaatgtcctgcattagtaggattagctata cgtcaagataatggtcaattcgaacctttagagatgacaccattttcattaccacctgat ttaccagatgttatgaaatctcaagaaactaatggacaagaacaatcaccttga

DBGET integrated database retrieval system