Altererythrobacter sp. B11: AEB_P2178 Help Entry AEB_P2178         CDS       T05671                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism alb  Altererythrobacter sp. B11 Brite KEGG Orthology (KO) [BR:alb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:alb03110]     AEB_P2178 Chaperones and folding catalysts [BR:alb03110]  Protein folding catalysts   Protein disulfide isomerase    AEB_P2178 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like DUF5685 Motif Other DBs NCBI-ProteinID:  BBC73046 UniProt:  A0A2Z5YY42 LinkDB All DBs Position 2281975..2282238 Genome browser AA seq 87 aa AA seqDB search MATPKVEIYTKFYCGYCQRAKSLLNSKGVEFTEYDVTMGGPDKDKMMERKPGASTVPQIF IDDKPIGGSDELAALDREGKLDALLGL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtggccactccaaaggttgaaatctataccaagttctattgcggctattgtcagcgcgcc aagagcctgctgaattctaagggcgtcgaattcacggaatacgacgtcaccatgggcggc ccggacaaggacaagatgatggagcgcaagcccggagcgagcaccgttccgcagatcttc atcgacgacaagccgatcggtggcagcgacgaactcgccgcgctcgaccgcgagggcaag ctggacgcgctgctcggcctgtga

DBGET integrated database retrieval system