Altererythrobacter sp. B11: AEB_P2734 Help Entry AEB_P2734         CDS       T05671                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alb  Altererythrobacter sp. B11 Pathway alb01100   Metabolic pathways alb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AEB_P2734    00074 Mycolic acid biosynthesis     AEB_P2734   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AEB_P2734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  BBC73602 UniProt:  A0A2Z5YZK0 LinkDB All DBs Position complement(2898093..2898329) Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVEHLGVEEDKVTPDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKINTVGDANKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgaagaagatcgtcgtcgaacatctcggcgtcgaggaa gacaaggtcacgccggacgccagcttcattgatgatctgggcgctgacagcctcgacatc gtggaactggtcatggccttcgaggaagagttcggggtcgagattccggacgatgcggcc gagaagatcaacacggtgggtgacgccaacaagtatatcgaagagcacaagggctaa

DBGET integrated database retrieval system