Alcanivorax sp. ALC70: ASALC70_00215 Help Entry ASALC70_00215     CDS       T09695                                  Symbol hupB Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism alca  Alcanivorax sp. ALC70 Brite KEGG Orthology (KO) [BR:alca00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:alca03032]     ASALC70_00215 (hupB)    03036 Chromosome and associated proteins [BR:alca03036]     ASALC70_00215 (hupB)    03400 DNA repair and recombination proteins [BR:alca03400]     ASALC70_00215 (hupB) DNA replication proteins [BR:alca03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ASALC70_00215 (hupB) Chromosome and associated proteins [BR:alca03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ASALC70_00215 (hupB) DNA repair and recombination proteins [BR:alca03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ASALC70_00215 (hupB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 FIMAH HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  UWN48040 LinkDB All DBs Position complement(190513..190785) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAAASDISKADAGRALDATLDAVTGALKKGDSVSLVGFGTFSVKERAAREG RNPQTGETIKIAAAKVPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatccgaactgatcgatgccatcgccgcggcctccgatatctccaaggccgac gcgggccgcgcgctggatgccactctggacgccgtgaccggtgctctgaaaaaaggcgac agcgtctccctggtgggttttggcactttctccgtgaaggagcgtgccgcgcgggaaggt cgtaacccgcagaccggcgaaaccatcaagatcgccgcggccaaggtgccgggcttcaag gccggtaaagcgctcaaggacgccgtgaactga

DBGET integrated database retrieval system