Alteromonas sp. Mac1: AV939_02730 Help Entry AV939_02730       CDS       T05687                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ale  Alteromonas sp. Mac1 Pathway ale01100   Metabolic pathways ale01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ale00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AV939_02730    00074 Mycolic acid biosynthesis     AV939_02730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AV939_02730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding_2 PP-binding Ribosomal_L50 FAS_N FANCI_S1 NUP160_helical_2 Motif Other DBs NCBI-ProteinID:  AMJ85591 LinkDB All DBs Position 644585..644848 Genome browser AA seq 87 aa AA seqDB search MGLDTVEIVLWAEEKFGVEMPDEEVTNICTVGEFANYIASKVNNEKGTNISFEEVMPDLL DVLEADYSVPRHKITLDSRFVQDLGFG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgggcttagatactgtagaaatcgtattgtgggctgaagagaagtttggtgtagaaatg ccggatgaagaagttactaatatctgtactgtcggagagtttgctaattacattgccagt aaagttaataacgaaaaaggcaccaacatcagctttgaggaagtaatgccggatctgctc gatgtgctggaggcggactatagtgtgccaagacataaaatcactttagatagtcggttt gtccaagatctaggttttggttag

DBGET integrated database retrieval system