Agrobacterium leguminum: CFBP4996_14895 Help Entry CFBP4996_14895    CDS       T09300                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aleg  Agrobacterium leguminum Pathway aleg00998   Biosynthesis of various antibiotics aleg01100   Metabolic pathways aleg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aleg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBP4996_14895    00074 Mycolic acid biosynthesis     CFBP4996_14895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBP4996_14895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  WFS67315 LinkDB All DBs Position Linear:76382..76618 Genome browser AA seq 78 aa AA seqDB search MSTIAERIRKIIVDQLGADPATIVDEASFADDLGADSLETVQIVMEIEEEFGVEIPDSAA STILTVGDAIRFVEKNKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtccaccattgcagaacgtatcagaaaaatcatcgtggaccagcttggcgcagaccct gccaccatcgtggacgaggccagttttgctgacgatctcggtgcggattcgctcgagacc gttcagatcgtcatggaaatcgaagaggaattcggggtggaaattccagattccgccgca agcacgatcctgaccgttggcgacgccatccgcttcgtcgaaaaaaacaaggcgtga

DBGET integrated database retrieval system