KEGG   Agrobacterium larrymoorei: CFBP5473_23940
Entry
CFBP5473_23940    CDS       T06268                                 
Name
(GenBank) FAD-binding oxidoreductase
  KO
K24953  nopaline oxidase subunit B
Organism
alf  Agrobacterium larrymoorei
Pathway
alf00330  Arginine and proline metabolism
alf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CFBP5473_23940
SSDB
Motif
Pfam: DAO Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox 3HCDH_N FAD_binding_3 ApbA FAD_binding_2 TrkA_N F420_oxidored UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: QCJ01015
UniProt: A0A4D7E199
LinkDB
Position
pTiCFBP5473:complement(211459..212577)
AA seq 372 aa
MDREFETAIVGGGVVGAAIGYGLAKLGRRVVIIDGADDALRASRTNFGLIWVQGKGDDYP
EYHRITRQSAELWPGFASELKELTGVDVEYRRNGGLLFCTSDAQAEEEKAIGEKMAAIHP
DYRFEMLERSRLERMLPDIRLGQKVCSASFSHMDGDVNPLLVLRALLAGFVRLGGTLVTG
EHVDSITPTLGGFRLATDALTIEAERVIIAAGNDSMAFARSLELPLQLVPEKGQLLITER
VAPVFPYAASGIRQTMTGTFQLGVTNERVGLSTDVTSGGARHIANRAINVMPDVGALRVV
RQWAGLRVLTPDGVPVYDRSRRYPGIHVVACHSGVTLAALHAGPFAEWLAAGGREPSYDA
FRGSRFKSGIAA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggatcgcgagttcgagacagctatcgttggaggcggtgtagttggcgccgccattgga
tatggcttggccaaactgggacgccgggtggtcatcatcgatggcgctgacgatgcgttg
cgcgcgtcgagaacgaattttggcctgatttgggttcagggcaagggcgacgactatccc
gaatatcatcgcatcacccgccaaagcgccgagttatggcccggttttgcatcggagtta
aaagaactgaccggtgtcgacgtcgaataccgtcgtaatggtggcctgctcttctgtacg
tcggacgctcaagcggaagaagaaaaggcgatcggcgagaagatggctgccatccacccc
gactatcgcttcgagatgctggagcgctcgcgccttgagcgcatgcttcctgacatccgt
cttgggcagaaggtttgttcggcgtccttcagtcatatggatggcgacgtcaatccgctc
ctcgtgcttcgcgcgttgctggccggatttgtgcgcctgggcggaaccctggtgacgggg
gaacacgtcgacagcataaccccgacccttggcggtttccggctggcgacagatgcgctc
acgatagaggcggagcgggtaattattgccgcgggcaatgactccatggcttttgcgagg
agcctggagcttccgcttcagcttgtcccggaaaaagggcagctcctcattacggaacgg
gtcgccccggtcttcccctacgccgccagcggcattcgtcagacgatgacgggcacgttt
cagctcggcgttacgaatgaacgcgtcggtctctcgaccgacgttacatctggtggcgcc
cgtcacatcgccaatcgcgcgatcaacgtgatgccggacgtcggcgctttgagggtcgtc
cggcagtgggcggggctacgcgttctgaccccggacggggtgccggtctacgatcggtcg
cgccgataccccggcattcatgtcgtggcctgtcattccggcgtcacccttgccgcgctg
cacgcaggtccttttgccgaatggctcgcagccggcggaagagagccgtcctacgacgct
tttcgcggcagccggttcaagagcgggatcgccgcatga

DBGET integrated database retrieval system