Algoriphagus sp. NBT04N3: GYM62_08930 Help Entry GYM62_08930       CDS       T09623                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism algo  Algoriphagus sp. NBT04N3 Pathway algo01100   Metabolic pathways algo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:algo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GYM62_08930    00074 Mycolic acid biosynthesis     GYM62_08930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GYM62_08930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 PP-binding_2 DMTF1_N Ribosomal_L12_N DUF5783 DUF2624 Motif Other DBs NCBI-ProteinID:  QYH38909 LinkDB All DBs Position 2047242..2047478 Genome browser AA seq 78 aa AA seqDB search MSEIAQKVKAIIVDKLGVEESEVTMEASFTNDLGADSLDTVELIMEFEKEFNISIPDDQA EQIGTVGQAVSYLEANVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgcacaaaaagtaaaagccatcatcgttgacaaactgggcgtagaagag tctgaagtgactatggaagcaagctttaccaatgacttgggagctgactctctagacact gtagaattgattatggaattcgagaaagaattcaacatctctatcccagatgatcaggct gagcaaatcggcacggtgggacaggctgtttcctaccttgaggctaacgtaaaataa

DBGET integrated database retrieval system