KEGG   Altererythrobacter sp. BO-6: G6N82_00615
Entry
G6N82_00615       CDS       T06465                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
alh  Altererythrobacter sp. BO-6
Pathway
alh00190  Oxidative phosphorylation
alh01100  Metabolic pathways
Module
alh_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:alh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    G6N82_00615
Enzymes [BR:alh01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     G6N82_00615
SSDB
Motif
Pfam: Oxidored_q3 DUF6479
Other DBs
NCBI-ProteinID: QIG52861
LinkDB
Position
129074..129697
AA seq 207 aa
MIQTLAFYLFAGLMIASALLVITARNPVHSVLWLILAFFNGAGLMVLVGAEFIAMLLVIV
YVGAVAVLFLFVVMMLNIDFAAMRAGFIKNFPLGLLIALILFLELFVGLVAYNAGGIALG
TPDGTAAQGLGQSNIEAIGALLYGRYIFLFEVAGIILLVAMIGAIVLTHRQRPDGTRARQ
DIGKQIRRRPEEATVMKNPEVGKGVEL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgatccaaaccttagccttctacctgttcgcagggctgatgatcgccagcgcgctgctg
gtgatcaccgcgcgcaacccggtgcattccgtactgtggctgatcctcgccttcttcaac
ggcgcggggctgatggtccttgtcggtgccgagttcatcgcgatgctgctggtgatcgtc
tatgtcggtgcggtcgcggtgctgttcctgttcgtggtgatgatgctgaacatcgatttc
gccgcaatgcgcgccgggttcatcaagaatttcccgctgggactgctgatcgcgctgatc
ctgttccttgagctgtttgtcggcctggttgcctataacgccggcgggattgcgctgggc
acgcccgatggcacggctgcacaggggctggggcagagcaatatcgaagcgatcggcgcg
ctcttgtatggccgctacatcttcctgttcgaagtggcgggcatcatcctgctggtggcg
atgatcggcgcgatcgtgctgacccaccgccagcgccccgatggtacgcgcgcgcggcag
gacatcggcaagcagatccgccgccgcccggaagaggctaccgtcatgaagaaccccgaa
gtgggcaagggggtcgagctgtga

DBGET integrated database retrieval system