Altererythrobacter sp. BO-6: G6N82_09850 Help Entry G6N82_09850       CDS       T06465                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alh  Altererythrobacter sp. BO-6 Pathway alh01100   Metabolic pathways alh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G6N82_09850    00074 Mycolic acid biosynthesis     G6N82_09850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G6N82_09850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 LpxI_N TRSP Motif Other DBs NCBI-ProteinID:  QIG54410 UniProt:  A0A6G6XAW2 LinkDB All DBs Position complement(2005986..2006228) Genome browser AA seq 80 aa AA seqDB search MDRAEVDTTIRSLIEPFNKKGVEITDATTFANDLEFDSLTVMDFVAEIEDAFDIIISMNQ QAEIENFGQLIDAVTKLQAD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgccgaagtcgacaccacaatccgctcgctgatcgagccgttcaacaagaag ggcgtcgagatcaccgatgcgacgaccttcgccaatgacctcgagttcgacagcctgacg gtgatggatttcgtcgccgagatcgaagacgcgttcgacatcatcatcagcatgaaccag caggccgagatcgagaatttcgggcagctgatcgatgcggtgaccaagctgcaggccgac tga

DBGET integrated database retrieval system