Alicyclobacillus sp. SO9: GI364_06720 Help Entry GI364_06720       CDS       T10284                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism alic  Alicyclobacillus sp. SO9 Pathway alic00020   Citrate cycle (TCA cycle) alic00720   Other carbon fixation pathways alic01100   Metabolic pathways alic01110   Biosynthesis of secondary metabolites alic01120   Microbial metabolism in diverse environments alic01200   Carbon metabolism alic01210   2-Oxocarboxylic acid metabolism Module alic_M00009   Citrate cycle (TCA cycle, Krebs cycle) alic_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite Enzymes [BR:alic01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GI364_06720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QQE80123 UniProt:  A0A7T5EWQ9 LinkDB All DBs Position 1486295..1486504 Genome browser AA seq 69 aa AA seqDB search MARVTFTEDTCKGCGLCIDVCPKNIIQFSDRLNVKGYHSATVPEEDMDQCIGCTFCAVMC PDVTIAVSL NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcgagagttacctttaccgaggacacttgtaagggttgtggactttgtatcgatgtc tgtcctaaaaacattattcagttttctgacaggctgaatgtgaaggggtatcattccgct acggttccggaagaagacatggatcagtgcattggctgtactttctgcgctgtcatgtgt ccggacgtaaccatcgcagtgagtctttag

DBGET integrated database retrieval system