Xiashengella succiniciproducens: M9189_05840 Help Entry M9189_05840       CDS       T08178                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism alkq  Xiashengella succiniciproducens Brite KEGG Orthology (KO) [BR:alkq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:alkq03032]     M9189_05840    03036 Chromosome and associated proteins [BR:alkq03036]     M9189_05840    03400 DNA repair and recombination proteins [BR:alkq03400]     M9189_05840 DNA replication proteins [BR:alkq03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     M9189_05840 Chromosome and associated proteins [BR:alkq03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     M9189_05840 DNA repair and recombination proteins [BR:alkq03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       M9189_05840 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  URW80871 UniProt:  A0A9J6ZT12 LinkDB All DBs Position 1395914..1396186 Genome browser AA seq 90 aa AA seqDB search MNKAQLIDAIAAESGLTKADSKKALDAFLKVTSEGLKKGDRITLVGFGSFLVSERSARTG RNPQTGKEIRIPAKKVVKFKAGSELNDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaagctcaattaattgatgcaatcgccgcggaatccggtttaaccaaggctgat tcaaaaaaagctttagatgctttcttaaaagttaccagcgaaggtcttaagaaaggtgat cgcattactttagtaggatttggctcttttttagtgtctgagagaagcgcacgcacaggt cgtaacccacaaaccggaaaagagattaggattcctgcaaagaaagtagtaaaattcaaa gccggtagcgagctgaatgattcagtaaactaa

DBGET integrated database retrieval system