Alloactinosynnema sp. L-07: CRK55396 Help Entry CRK55396          CDS       T04489                                  Name (GenBank) POSSIBLE GLUTAREDOXIN PROTEIN   KO K18917   mycoredoxin [EC:1.20.4.3] Organism alo  Alloactinosynnema sp. L-07 Brite KEGG Orthology (KO) [BR:alo00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CRK55396 Enzymes [BR:alo01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CRK55396 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin Thioredoxin_2 GST_N_3 Glrx-like GST_N Motif Other DBs NCBI-ProteinID:  CRK55396 UniProt:  A0A0H5CCI9 LinkDB All DBs Position I:complement(407220..407468) Genome browser AA seq 82 aa AA seqDB search MSAPTTLTMYSTTWCGYCRRLKTLLKADGIEFVEVDIEETPNAAEFVMSVNGGNQTVPTL HFPSGAALTNPSLAEVKELLAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcggcacccaccaccctcaccatgtactcgaccacctggtgcggctactgccgcagg ctcaagaccctgctgaaggccgacggcatcgagttcgtcgaggtcgacatcgaggagacc ccgaacgcggcggagttcgtgatgagcgtcaacggcggcaaccagacggtgcccacgctg cacttccccagcggtgccgcgctgaccaacccgagcctggccgaggtcaaggagttgctc gccgcgtag

DBGET integrated database retrieval system