Alloactinosynnema sp. L-07: CRK58487 Help Entry CRK58487          CDS       T04489                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism alo  Alloactinosynnema sp. L-07 Pathway alo00362   Benzoate degradation alo00621   Dioxin degradation alo00622   Xylene degradation alo01100   Metabolic pathways alo01120   Microbial metabolism in diverse environments alo01220   Degradation of aromatic compounds Module alo_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:alo00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CRK58487    00622 Xylene degradation     CRK58487    00621 Dioxin degradation     CRK58487 Enzymes [BR:alo01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CRK58487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  CRK58487 UniProt:  A0A0H5CL67 LinkDB All DBs Position I:complement(3708557..3708736) Genome browser AA seq 59 aa AA seqDB search MPLISVSMYPGRTPEQKAELVAKLTDAFVETCGGTRDGVWVMVNEVAPENWAVGGELRG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt gtgccgttgatctcggtatcgatgtatccggggcgcacgcccgagcagaaggccgaactg gtcgccaagctgaccgacgccttcgtggagacctgcggcggcacccgcgacggcgtgtgg gtcatggtgaacgaggtcgcgccagaaaactgggccgtgggcggggagcttcgcggatag

DBGET integrated database retrieval system