Pseudoprevotella muciniphila: C7Y71_001685 Help Entry C7Y71_001685      CDS       T06230                                  Symbol atpC Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism alq  Pseudoprevotella muciniphila Pathway alq00190   Oxidative phosphorylation alq01100   Metabolic pathways Module alq_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:alq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C7Y71_001685 (atpC)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:alq00194]     C7Y71_001685 (atpC) Photosynthesis proteins [BR:alq00194]  Photosystem and electron transport system   F-type ATPase [OT]    C7Y71_001685 (atpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QFQ11833 UniProt:  A0A5P8E4A7 LinkDB All DBs Position 396441..396677 Genome browser AA seq 78 aa AA seqDB search MLNVTVVSPEKTLFAGQVDSVFVPGKKGKFEILQNHAPIVSILTEGIVRCVGSETFEIAI KAGFVEVSNNEVSVCIEV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgctgaacgttacagttgtctcaccagaaaagacattatttgccggtcaggtggatagc gtctttgtccctggcaaaaagggtaaatttgaaattcttcaaaaccatgccccgatagtc tccatccttactgaaggcattgtgagatgtgtgggtagtgaaacttttgaaattgccatc aaagcaggttttgtagaagtttcaaacaacgaagtatctgtttgcattgaagtctaa

DBGET integrated database retrieval system