Alteromonas sp. RKMC-009: DS731_16685 Help Entry DS731_16685       CDS       T05653                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alr  Alteromonas sp. RKMC-009 Pathway alr01100   Metabolic pathways alr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DS731_16685    00074 Mycolic acid biosynthesis     DS731_16685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DS731_16685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF7080 Motif Other DBs NCBI-ProteinID:  AYA65525 UniProt:  A0A385MXK2 LinkDB All DBs Position complement(3750363..3750617) Genome browser AA seq 84 aa AA seqDB search MNAEKENILAQVRDTLVDLFELEPAEIVPEARLYEDLDIDSIDAVDLLVDLKKTINVEIS PSQFKQVRTIQDVVDVLAELPAKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatgcggaaaaagaaaatatcctggcacaggtcagagacaccttagtagaccttttc gagctggaaccggcggaaatcgtgcctgaagcccgtctttatgaagacctggatatcgac agcattgatgccgtagatttactggttgacctgaaaaagaccattaacgtagaaatctct ccgtctcagttcaagcaggtgagaaccatacaggacgtcgttgacgtactggctgagttg ccggcgaaagcgtaa

DBGET integrated database retrieval system