Alteromonas naphthalenivorans: ambt_09980 Help Entry ambt_09980        CDS       T01513                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alt  Alteromonas naphthalenivorans Pathway alt01100   Metabolic pathways alt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ambt_09980 (acpP)    00074 Mycolic acid biosynthesis     ambt_09980 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ambt_09980 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Motif Other DBs NCBI-ProteinID:  AEF03522 UniProt:  F5Z8X9 LinkDB All DBs Position complement(2226300..2226539) Genome browser AA seq 79 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEEVKAEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQSAIDYINANKDA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtaacattgaagaacgcgttaagaaaattatcattgaacaacttggcgtaaaagaa gaagaagtaaaagctgaagcttcattcgttgatgatttgggcgcagactcacttgacact gttgagctagtaatggcgttagaagaagaatttgatactgaaattcctgacgaagaagca gaaaaaattactactgttcagtcagctattgactacatcaatgctaacaaagacgcttaa

DBGET integrated database retrieval system