Altererythrobacter arenosus: P7228_15840 Help Entry P7228_15840       CDS       T10597                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism altc  Altererythrobacter arenosus Pathway altc01100   Metabolic pathways altc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:altc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P7228_15840    00074 Mycolic acid biosynthesis     P7228_15840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P7228_15840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WFL77439 UniProt:  A0ABY8FQZ4 LinkDB All DBs Position complement(3195146..3195382) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggcgtcgaggcc gacaaggtcacccaagaagccagcttcatcgatgatctgggcgcagacagcctcgacatc gtcgaactcgtgatggccttcgaagaagaattcggcgtggaaatcccggacgatgcggcc gaaaagatcaccacggtcggtgacgccacgaaatacatcgaagaacacaagggctaa

DBGET integrated database retrieval system