Constantimarinum furrinae: ALE3EI_1222 Help Entry ALE3EI_1222       CDS       T06763                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alti  Constantimarinum furrinae Pathway alti01100   Metabolic pathways alti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ALE3EI_1222    00074 Mycolic acid biosynthesis     ALE3EI_1222   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ALE3EI_1222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNJ97787 UniProt:  A0A7G8PTX1 LinkDB All DBs Position 1349488..1349745 Genome browser AA seq 85 aa AA seqDB search MTELKQELKENIIELLNLEDIAVDEIADDDALFGDGLGLDSIDALELIVMLDKDYGIKLT DPKEGKEIFQSITVLANYIAKHRTK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactgaattaaaacaagaactgaaggaaaatattattgaactgttgaaccttgaagac attgcagtagatgaaattgccgatgacgacgctttatttggagacggtctggggttggat tccatagacgctctggaattgatcgtaatgttggataaggattacggaataaaattaacc gaccccaaagaaggaaaagagatctttcagtcaattacggttttagcaaattacattgcc aagcacaggacaaaatag

DBGET integrated database retrieval system