Allobranchiibius sp. GilTou73: LVQ62_16280 Help Entry LVQ62_16280       CDS       T07800                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism alx  Allobranchiibius sp. GilTou73 Pathway alx01100   Metabolic pathways alx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:alx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVQ62_16280    00074 Mycolic acid biosynthesis     LVQ62_16280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVQ62_16280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UIJ34633 LinkDB All DBs Position complement(3303513..3303764) Genome browser AA seq 83 aa AA seqDB search MTTLPRDQVRSMMGEVLAAQGKELPAEDGALLETIGFRSLDFSELALRVEDELDEELNFD APGLRSIETVGDVLTFIDQLQQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccacccttccccgtgaccaggtccgcagcatgatgggcgaggtcctcgccgcgcag ggcaaggaacttcccgccgaggacggcgcgctgctggagaccatcggcttccgctccctg gatttctccgagttggcgctgcgtgtcgaggacgagttggacgaggagctgaacttcgac gctcccggtctgcggtcgatcgagacggtgggggacgtcctcaccttcatcgaccagctg cagcaggcgtga

DBGET integrated database retrieval system