Arabidopsis lyrata (lyrate rockcress): 9301759 Help Entry 9301759           CDS       T01578                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03018   RNA degradation aly03040   Spliceosome Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     9301759   09123 Folding, sorting and degradation    03018 RNA degradation     9301759  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aly03019]     9301759    03041 Spliceosome [BR:aly03041]     9301759 Messenger RNA biogenesis [BR:aly03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      9301759   mRNA degradation factors    5'-3' decay     Lsm complex      9301759 Spliceosome [BR:aly03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     9301759 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 SM-ATX Swm2 Motif Other DBs NCBI-GeneID:  9301759 NCBI-ProteinID:  XP_002863925 UniProt:  D7MMN2 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MASNPSQLLPSELIDRCIGSKIWVIMKGDKELVGILKGFDVYVNMVLEDVTEYEITAEGR RVTKLDQILLNGNNIAILVPGGSPEDGE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcgagcaatccttcgcagcttcttccatcagagctaatcgataggtgcataggatcg aagatatgggtgattatgaaaggagataaggagcttgttggtattcttaaaggcttcgat gtttatgtcaacatggttcttgaagatgtcaccgaatatgagatcacagctgaaggaaga cgggtcacaaagcttgatcagattctactcaatggcaacaacatcgccattttggtgcct ggtgggtctcccgaagatggagaatga

DBGET integrated database retrieval system