Arabidopsis lyrata (lyrate rockcress): 9303190 Help Entry 9303190           CDS       T01578                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03083   Polycomb repressive complex aly04120   Ubiquitin mediated proteolysis aly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9303190    04120 Ubiquitin mediated proteolysis     9303190   09126 Chromosome    03083 Polycomb repressive complex     9303190  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9303190    04121 Ubiquitin system [BR:aly04121]     9303190    03036 Chromosome and associated proteins [BR:aly03036]     9303190 Membrane trafficking [BR:aly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     9303190 Ubiquitin system [BR:aly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      9303190    Cul7 complex      9303190 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      9303190   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      9303190 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  9303190 NCBI-ProteinID:  XP_002867118 UniProt:  D7MF10 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MSSTMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCAANGIPLANVTSKTLAKVIEYCK KHHVDEANPISEDELKKWDTEFMETDQSTIFDLILAANYLNIKSLLDLTCQTIADMIKGK NPEEIRTLFNIKNDFTPEEEEEVRRENQWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgacgatgatcgtgttgatgagctccgatggtcagtcgtttgaggtggaagaa gcggtagcaatccaatctcagaccatagcacatatggttgaagacgattgcgccgctaat ggaatccctcttgcaaacgtgacaagcaagactcttgcgaaagtgattgagtactgcaag aagcaccacgtcgatgaggctaaccctatctctgaagatgaactcaagaagtgggacacg gagttcatggaaaccgatcaatccacgatatttgatctcattcttgctgcgaattaccta aacatcaaaagcttgcttgatctcacatgtcaaactattgcggatatgatcaaaggcaag aatccagaggagattcgtacacttttcaacattaagaatgattttacacctgaggaggaa gaagaggttcgtagggagaatcaatgggcttttgaatga

DBGET integrated database retrieval system