KEGG   Arabidopsis lyrata (lyrate rockcress): 9303371
Entry
9303371           CDS       T01578                                 
Name
(RefSeq) cytochrome P450 83B1
  KO
K11818  aromatic aldoxime N-monooxygenase [EC:1.14.14.45]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00380  Tryptophan metabolism
aly00966  Glucosinolate biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01210  2-Oxocarboxylic acid metabolism
Module
aly_M00370  Glucosinolate biosynthesis, tryptophan => glucobrassicin
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    9303371
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    9303371
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aly00199]
    9303371
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.45  aromatic aldoxime N-monooxygenase
     9303371
Cytochrome P450 [BR:aly00199]
 Cytochrome P450, plant type
  CYP83 family
   9303371
SSDB
Motif
Pfam: p450 FANCI_S2 Goodbye Transposase_31
Other DBs
NCBI-GeneID: 9303371
NCBI-ProteinID: XP_002867299
UniProt: D7MB60
LinkDB
Position
Unknown
AA seq 499 aa
MDLFLIIAALVAAAAFFFLRSTTKKSLRLPPGPKGLPIIGNLHQMEKFNPQHFLFRLSKL
YGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTA
YYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCV
VCRQAFGKRYNEYGTEMKRFIDILYETQALLGTLFFSDLFPYFGFLDNLTGLSARLKKAF
KELDTYLQELLDETLDPNRPKQETESFIDLLMQIYKDQPFSIKFTHENVKAMILDIVVPG
TDTAAAVVVWAMTYLIKYPEAMKKAQDEVRNVIGDKGYVSEEDIPNLPYLKAVIKESLRL
EPVIPILLHRETIADAKIGGYDIPAKTIIQVNAWAVSRDTAAWGDNPNEFIPERFMKEHK
GVDFKGQDFELLPFGSGRRMCPAMHLGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVM
TGLAMHKKEHLVLAPTKHI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggatctcttcttgattatagccgctttggtagcggctgcagccttctttttcctccgt
agcacgaccaagaaatctctccggctacctccgggaccaaaaggtcttcctattatagga
aaccttcaccagatggagaaattcaatccacaacacttccttttccgtctctccaagcta
tacggcccgattttcacgatgaaaatcggaggccgtcgcctagcggtgatctcctcggcc
gagctagccaaggagctactcaagactcaagacctcaacttcaccgctcgtcctctcttg
aaagggcaacaaacgatgtcgtatcaaggccgtgagcttggtttcggacagtacaccgcc
tactaccgtgagatgaggaagatgtgtatggtgaacctcttcagcccaaaccgtgtcgca
agtttcagaccggttagagaagaagagtgtcaacggatgatggacaagatctacaaagcc
gctgatcaatcaggcaccgttgatctaagtgagcttctcttgtctttcaccaactgtgtc
gtatgtagacaagcttttgggaaacggtacaatgagtacggtacagagatgaagagattc
atagacatcttgtacgagacgcaagcacttttgggcactctgtttttctccgacctcttt
ccttattttggattccttgacaacctcactggtcttagtgcgcgtctcaagaaagctttt
aaggagcttgacacttaccttcaagaacttctagacgagactcttgaccctaaccgccct
aaacaagaaacagagagtttcattgatctattgatgcagatctacaaagaccaacctttc
tccatcaaatttactcacgaaaatgtcaaggccatgatattggatattgttgtgccggga
actgacacggcggctgcggtggtggtatgggccatgacttaccttataaagtaccctgaa
gcgatgaagaaagctcaagacgaagtgaggaatgtgataggcgacaaaggatatgtctct
gaagaagacatacctaatctcccttacctcaaggcagtcatcaaggagtctcttcggctc
gaaccagtcatccccattcttctacacagagaaactatcgcagacgcaaagatcggtggc
tatgatatcccggccaagaccatcattcaggtgaacgcgtgggcggtttctcgtgacaca
gccgcgtggggagacaaccctaatgagttcattccagagaggttcatgaaggagcacaaa
ggagtggacttcaagggccaagattttgagctcctacctttcgggtcgggccggagaatg
tgcccggccatgcatcttgggatcgcaatggtagagatacctttcgctaaccttctctac
aaatttgactggagtctacctaaagggattaaaccagaggatataaagatggacgtcatg
actggactcgctatgcacaagaaagaacacctcgtccttgcaccaacgaaacacatctga

DBGET integrated database retrieval system