Arabidopsis lyrata (lyrate rockcress): 9309455 Help Entry 9309455           CDS       T01578                                  Name (RefSeq) ubiquitin   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03010   Ribosome aly04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     9309455   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     9309455  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:aly03011]     9309455    04121 Ubiquitin system [BR:aly04121]     9309455 Ribosome [BR:aly03011]  Ribosomal proteins   Eukaryotes    Large subunit     9309455   Archaea     9309455 Ubiquitin system [BR:aly04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    9309455 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Plexin_RBD PI3K_p85B Motif Other DBs NCBI-GeneID:  9309455 NCBI-ProteinID:  XP_002873387 UniProt:  D7M214 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MQVFIKTITGETYCVDVEKTDTISKMKTKIYNAMGLEPAYQYLVHGKNVLEVHGGATVGD YGIEARAKIQLTKRMRGG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgcaagtgtttatcaaaactatcacgggggagacttactgtgtcgatgtcgaaaaaact gacactatctctaaaatgaaaacaaaaatatataacgctatgggtttggaaccggcatac caatacctcgttcacggcaagaatgtgctcgaggtccatggcggagctacggtgggtgat tacggaatcgaagctcgcgccaagatccagttaaccaagcgtatgcgtggtggatga

DBGET integrated database retrieval system