Arabidopsis lyrata (lyrate rockcress): 9311262 Help Entry 9311262           CDS       T01578                                  Name (RefSeq) SKP1-like protein 14   KO K03094   S-phase kinase-associated protein 1 Organism aly  Arabidopsis lyrata (lyrate rockcress) Pathway aly03083   Polycomb repressive complex aly04120   Ubiquitin mediated proteolysis aly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     9311262    04120 Ubiquitin mediated proteolysis     9311262   09126 Chromosome    03083 Polycomb repressive complex     9311262  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aly04131]     9311262    04121 Ubiquitin system [BR:aly04121]     9311262    03036 Chromosome and associated proteins [BR:aly03036]     9311262 Membrane trafficking [BR:aly04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     9311262 Ubiquitin system [BR:aly04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      9311262    Cul7 complex      9311262 Chromosome and associated proteins [BR:aly03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      9311262   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      9311262 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Skp1 DUF7376 MRP-S27 HisK-N-like Motif Other DBs NCBI-GeneID:  9311262 NCBI-ProteinID:  XP_002875194 UniProt:  D7LQF0 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSSNKIVLTSSDGESFEVEEVVARKLQIVGHMLEDDCVINEIPLQNVTGDILSMVIEYCK THVDEEESEEAQTKLKTWDEEFMKKFDIKTLLQIILAANYLNVKGLLDLVSQTIADTIKD YTPEQIREVFGVENDYTEEEEAEVRKENAWAFDEADTPKP NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaaacaagattgttttgactagctccgatggcgaatctttcgaggttgaagaa gtggtagcaagaaaacttcagatcgtaggacacatgctcgaagacgactgtgttattaac gaaatccctcttcaaaacgttaccggagatatcctctccatggttatcgagtattgcaaa acacacgtcgacgaagaagaaagcgaggaagctcagacgaagctcaagacttgggacgaa gagttcatgaagaaatttgatatcaaaacactcttacaaatcattctcgctgctaactat ctcaatgttaaaggccttcttgatctcgtttctcagacaattgcagataccatcaaagat tacacgccagaacaaattcgagaagtcttcggagtcgagaacgattacactgaggaggaa gaagcagaggttcgcaaggaaaacgcatgggcttttgatgaggctgatacaccaaaaccc tag

DBGET integrated database retrieval system